BLASTX nr result
ID: Akebia25_contig00047521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00047521 (205 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004497571.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 57 3e-06 >ref|XP_004497571.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP16-4, chloroplastic-like isoform X1 [Cicer arietinum] Length = 269 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/71 (47%), Positives = 44/71 (61%), Gaps = 3/71 (4%) Frame = +2 Query: 2 VSTSRRAVRFFLF---VNEFSLLHRWHLNSIISSLFYDIFFNNLQLRSAKIPESEFTTLP 172 VSTSRRAV + V+ +++ W+ + F +QLR AKIPES++ TLP Sbjct: 92 VSTSRRAVCVPIIRKNVDSENMITNWNCAFL--------GFGFMQLRGAKIPESDYKTLP 143 Query: 173 NGLKYYDLKVG 205 NGLKYYDLKVG Sbjct: 144 NGLKYYDLKVG 154