BLASTX nr result
ID: Akebia25_contig00047343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00047343 (238 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849468.1| hypothetical protein AMTR_s00024p00094630 [A... 79 7e-13 ref|XP_007010890.1| Homeobox-leucine zipper protein HDG11 [Theob... 76 6e-12 gb|EXB80256.1| Homeobox-leucine zipper protein HDG11 [Morus nota... 74 3e-11 gb|EYU22268.1| hypothetical protein MIMGU_mgv1a002027mg [Mimulus... 72 8e-11 ref|XP_006374212.1| hypothetical protein POPTR_0015s05050g [Popu... 72 1e-10 ref|XP_006374213.1| homeobox-leucine zipper family protein [Popu... 72 1e-10 ref|XP_004137568.1| PREDICTED: homeobox-leucine zipper protein H... 71 1e-10 ref|XP_006364383.1| PREDICTED: homeobox-leucine zipper protein H... 71 2e-10 ref|XP_006347370.1| PREDICTED: homeobox-leucine zipper protein H... 71 2e-10 ref|XP_007152327.1| hypothetical protein PHAVU_004G120500g [Phas... 71 2e-10 ref|XP_004241474.1| PREDICTED: homeobox-leucine zipper protein H... 71 2e-10 ref|XP_007210461.1| hypothetical protein PRUPE_ppa015345m2g, par... 70 2e-10 tpg|DAA34952.1| TPA_exp: homeodomain leucine zipper family IV pr... 70 2e-10 ref|NP_001105125.1| outer cell layer3 [Zea mays] gi|8920423|emb|... 70 2e-10 ref|XP_006478112.1| PREDICTED: homeobox-leucine zipper protein H... 70 3e-10 ref|XP_006441353.1| hypothetical protein CICLE_v10019153mg [Citr... 70 3e-10 ref|XP_003530982.1| PREDICTED: homeobox-leucine zipper protein H... 70 4e-10 ref|XP_003524332.1| PREDICTED: homeobox-leucine zipper protein H... 70 4e-10 ref|XP_004957413.1| PREDICTED: homeobox-leucine zipper protein R... 69 5e-10 ref|XP_003578477.1| PREDICTED: homeobox-leucine zipper protein R... 69 5e-10 >ref|XP_006849468.1| hypothetical protein AMTR_s00024p00094630 [Amborella trichopoda] gi|548853043|gb|ERN11049.1| hypothetical protein AMTR_s00024p00094630 [Amborella trichopoda] Length = 701 Score = 79.0 bits (193), Expect = 7e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +1 Query: 118 DEQDVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEKQ 237 D+QD SDPQRKKKR+HRHTAHQIQ+LEA+FKE PHPDEKQ Sbjct: 7 DDQDASDPQRKKKRYHRHTAHQIQELEAMFKENPHPDEKQ 46 >ref|XP_007010890.1| Homeobox-leucine zipper protein HDG11 [Theobroma cacao] gi|508727803|gb|EOY19700.1| Homeobox-leucine zipper protein HDG11 [Theobroma cacao] Length = 842 Score = 75.9 bits (185), Expect = 6e-12 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +1 Query: 121 EQDVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEKQ 237 + D SDP R+KKR+HRHTAHQIQ+LEA+FKECPHPDEKQ Sbjct: 14 DHDASDPSRRKKRYHRHTAHQIQRLEAMFKECPHPDEKQ 52 >gb|EXB80256.1| Homeobox-leucine zipper protein HDG11 [Morus notabilis] Length = 721 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = +1 Query: 121 EQDVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEKQ 237 + D SD QR+KKR+HRHTAHQIQ+LE++FKECPHPDEKQ Sbjct: 13 DNDASDAQRRKKRYHRHTAHQIQKLESMFKECPHPDEKQ 51 >gb|EYU22268.1| hypothetical protein MIMGU_mgv1a002027mg [Mimulus guttatus] Length = 725 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 127 DVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEK 234 D SDP R+KKR+HRHTAHQIQ+LE++FKECPHPDEK Sbjct: 19 DASDPHRRKKRYHRHTAHQIQRLESMFKECPHPDEK 54 >ref|XP_006374212.1| hypothetical protein POPTR_0015s05050g [Populus trichocarpa] gi|550321969|gb|ERP52009.1| hypothetical protein POPTR_0015s05050g [Populus trichocarpa] Length = 707 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = +1 Query: 121 EQDVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEKQ 237 + D SDPQR+KKR+HRHTA QIQ+LE++FKECPHPDEKQ Sbjct: 17 DHDSSDPQRRKKRYHRHTALQIQKLESMFKECPHPDEKQ 55 >ref|XP_006374213.1| homeobox-leucine zipper family protein [Populus trichocarpa] gi|550321970|gb|ERP52010.1| homeobox-leucine zipper family protein [Populus trichocarpa] Length = 725 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = +1 Query: 121 EQDVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEKQ 237 + D SDPQR+KKR+HRHTA QIQ+LE++FKECPHPDEKQ Sbjct: 17 DHDSSDPQRRKKRYHRHTALQIQKLESMFKECPHPDEKQ 55 >ref|XP_004137568.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Cucumis sativus] gi|449517265|ref|XP_004165666.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Cucumis sativus] Length = 705 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +1 Query: 118 DEQDVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEKQ 237 D SDPQR+KKR+HRH A+QIQ+LEA+FKECPHPDEKQ Sbjct: 10 DNDPSSDPQRRKKRYHRHNANQIQRLEAMFKECPHPDEKQ 49 >ref|XP_006364383.1| PREDICTED: homeobox-leucine zipper protein HDG11-like, partial [Solanum tuberosum] Length = 705 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +1 Query: 118 DEQDVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEK 234 D D SD QR+KKR+HRHTA+QIQ+LEA+FKECPHPDEK Sbjct: 3 DPHDGSDSQRRKKRYHRHTANQIQKLEAIFKECPHPDEK 41 >ref|XP_006347370.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Solanum tuberosum] Length = 715 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 127 DVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEK 234 D +D RKKKRFHRHTAHQIQ LE+VFKECPHPDEK Sbjct: 21 DATDAHRKKKRFHRHTAHQIQSLESVFKECPHPDEK 56 >ref|XP_007152327.1| hypothetical protein PHAVU_004G120500g [Phaseolus vulgaris] gi|561025636|gb|ESW24321.1| hypothetical protein PHAVU_004G120500g [Phaseolus vulgaris] Length = 743 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = +1 Query: 118 DEQDVSD--PQRKKKRFHRHTAHQIQQLEAVFKECPHPDEKQ 237 D+QDV D PQRKKK++HRHT QIQ LEA FKECPHPDEKQ Sbjct: 43 DDQDVGDDQPQRKKKKYHRHTPQQIQDLEAFFKECPHPDEKQ 84 >ref|XP_004241474.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Solanum lycopersicum] Length = 717 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 127 DVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEK 234 D +D RKKKRFHRHTAHQIQ LE+VFKECPHPDEK Sbjct: 23 DATDASRKKKRFHRHTAHQIQSLESVFKECPHPDEK 58 >ref|XP_007210461.1| hypothetical protein PRUPE_ppa015345m2g, partial [Prunus persica] gi|462406196|gb|EMJ11660.1| hypothetical protein PRUPE_ppa015345m2g, partial [Prunus persica] Length = 143 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +1 Query: 121 EQDVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEKQ 237 + D SD QR+KKR+HRHTA+QIQ+LE +FKECPHPDEKQ Sbjct: 14 DHDASDSQRRKKRYHRHTANQIQKLEGMFKECPHPDEKQ 52 >tpg|DAA34952.1| TPA_exp: homeodomain leucine zipper family IV protein [Zea mays] gi|414886368|tpg|DAA62382.1| TPA: outer cell layer3 [Zea mays] Length = 863 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +1 Query: 121 EQDVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEKQ 237 + D S+P+RKKKR+HRHT QIQ+LEAVFKECPHPDEKQ Sbjct: 111 DPDNSNPRRKKKRYHRHTPQQIQELEAVFKECPHPDEKQ 149 >ref|NP_001105125.1| outer cell layer3 [Zea mays] gi|8920423|emb|CAB96423.1| OCL3 protein [Zea mays] Length = 863 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +1 Query: 121 EQDVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEKQ 237 + D S+P+RKKKR+HRHT QIQ+LEAVFKECPHPDEKQ Sbjct: 111 DPDNSNPRRKKKRYHRHTPQQIQELEAVFKECPHPDEKQ 149 >ref|XP_006478112.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Citrus sinensis] Length = 714 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +1 Query: 121 EQDVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEKQ 237 + D SDPQ++KKR+HRHTA QIQ+LEA+FK+CPHPDEKQ Sbjct: 19 DHDGSDPQKRKKRYHRHTALQIQRLEAMFKDCPHPDEKQ 57 >ref|XP_006441353.1| hypothetical protein CICLE_v10019153mg [Citrus clementina] gi|557543615|gb|ESR54593.1| hypothetical protein CICLE_v10019153mg [Citrus clementina] Length = 680 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +1 Query: 121 EQDVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEKQ 237 + D SDPQ++KKR+HRHTA QIQ+LEA+FK+CPHPDEKQ Sbjct: 19 DHDGSDPQKRKKRYHRHTALQIQRLEAMFKDCPHPDEKQ 57 >ref|XP_003530982.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X1 [Glycine max] gi|571470104|ref|XP_006584922.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X2 [Glycine max] gi|571470106|ref|XP_006584923.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X3 [Glycine max] gi|571470109|ref|XP_006584924.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X4 [Glycine max] gi|571470111|ref|XP_006584925.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X5 [Glycine max] Length = 721 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +1 Query: 121 EQDVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEKQ 237 EQD SD Q ++KR+HRHTA+QIQ+LE++FKECPHPDEKQ Sbjct: 15 EQDGSDSQERRKRYHRHTANQIQRLESMFKECPHPDEKQ 53 >ref|XP_003524332.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Glycine max] Length = 713 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +1 Query: 121 EQDVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEKQ 237 EQD SD Q ++KR+HRHTA+QIQ+LE++FKECPHPDEKQ Sbjct: 11 EQDGSDSQERRKRYHRHTANQIQRLESMFKECPHPDEKQ 49 >ref|XP_004957413.1| PREDICTED: homeobox-leucine zipper protein ROC6-like [Setaria italica] Length = 860 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +1 Query: 121 EQDVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEKQ 237 + D S+P++KKKR+HRHT QIQ+LEAVFKECPHPDEKQ Sbjct: 113 DPDNSNPRKKKKRYHRHTPQQIQELEAVFKECPHPDEKQ 151 >ref|XP_003578477.1| PREDICTED: homeobox-leucine zipper protein ROC6-like isoform 3 [Brachypodium distachyon] Length = 858 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +1 Query: 121 EQDVSDPQRKKKRFHRHTAHQIQQLEAVFKECPHPDEKQ 237 + D S+P++KKKR+HRHT QIQ+LEAVFKECPHPDEKQ Sbjct: 110 DPDNSNPRKKKKRYHRHTPQQIQELEAVFKECPHPDEKQ 148