BLASTX nr result
ID: Akebia25_contig00047273
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00047273 (506 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EWG51321.1| hypothetical protein FVEG_16784 [Fusarium vertici... 62 6e-08 gb|EJT71139.1| hypothetical protein GGTG_10399 [Gaeumannomyces g... 61 1e-07 ref|XP_001806136.1| hypothetical protein SNOG_16005 [Phaeosphaer... 61 2e-07 gb|EQB53989.1| hypothetical protein CGLO_06227 [Colletotrichum g... 59 5e-07 ref|XP_003003085.1| conserved hypothetical protein [Verticillium... 59 7e-07 gb|EFW13470.1| hypothetical protein CPSG_09922 [Coccidioides pos... 59 9e-07 gb|EFQ25271.1| hypothetical protein GLRG_00415 [Colletotrichum g... 57 3e-06 >gb|EWG51321.1| hypothetical protein FVEG_16784 [Fusarium verticillioides 7600] gi|587662920|gb|EWY85261.1| hypothetical protein FOYG_12499 [Fusarium oxysporum FOSC 3-a] gi|587689107|gb|EWZ35712.1| hypothetical protein FOZG_11578 [Fusarium oxysporum Fo47] gi|587724955|gb|EWZ96292.1| hypothetical protein FOWG_03707 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587740124|gb|EXA37840.1| hypothetical protein FOVG_11928 [Fusarium oxysporum f. sp. pisi HDV247] gi|590028283|gb|EXK30141.1| hypothetical protein FOMG_13780 [Fusarium oxysporum f. sp. melonis 26406] gi|590062745|gb|EXK90269.1| hypothetical protein FOQG_07096 [Fusarium oxysporum f. sp. raphani 54005] gi|591420113|gb|EXL55250.1| hypothetical protein FOCG_05914 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591449386|gb|EXL81768.1| hypothetical protein FOPG_05108 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591474467|gb|EXM05656.1| hypothetical protein FOIG_04172 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591497742|gb|EXM27212.1| hypothetical protein FOTG_06566 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 42 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = +2 Query: 362 MPFLWTKNVGGKHAGAGITVDRHGVRRNPFRFSLGKLNCFR 484 M W+K VGG+H G + VD+HGVRR P+RFSLGK +CFR Sbjct: 1 MGLFWSKGVGGRHFGTSVHVDKHGVRRGPWRFSLGKFSCFR 41 >gb|EJT71139.1| hypothetical protein GGTG_10399 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 151 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = +2 Query: 362 MPFLWTKNVGGKHAGAGITVDRHGVRRNPFRFSLGKLNCFR 484 MPF ++K GG+H G + DRHGVRR P+RFSLG+ NCF+ Sbjct: 108 MPFFYSKAFGGRHFGTSVHADRHGVRRGPWRFSLGRFNCFK 148 >ref|XP_001806136.1| hypothetical protein SNOG_16005 [Phaeosphaeria nodorum SN15] gi|111055464|gb|EAT76584.1| hypothetical protein SNOG_16005 [Phaeosphaeria nodorum SN15] Length = 41 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +2 Query: 362 MPFLWTKNVGGKHAGAGITVDRHGVRRNPFRFSLGKLNCFR 484 M +W K GG+HAG G+ DRHGVRR PFR S G+ +CFR Sbjct: 1 MGLMWHKGFGGRHAGGGVVADRHGVRRAPFRLSCGRFSCFR 41 >gb|EQB53989.1| hypothetical protein CGLO_06227 [Colletotrichum gloeosporioides Cg-14] Length = 190 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/41 (53%), Positives = 31/41 (75%) Frame = +2 Query: 362 MPFLWTKNVGGKHAGAGITVDRHGVRRNPFRFSLGKLNCFR 484 MPF ++K +GGK+ G + DRHG+RR P+RF +G+ NCFR Sbjct: 150 MPFFYSKPIGGKNFGTSVHADRHGIRRGPWRFRIGRFNCFR 190 >ref|XP_003003085.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] gi|261358109|gb|EEY20537.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] gi|346971083|gb|EGY14535.1| hypothetical protein VDAG_05699 [Verticillium dahliae VdLs.17] Length = 41 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = +2 Query: 362 MPFLWTKNVGGKHAGAGITVDRHGVRRNPFRFSLGKLNCFR 484 MPF + K+VGG+ G I DRHGVRR P+RF +G+ NCF+ Sbjct: 1 MPFFYNKSVGGRRFGTSIQADRHGVRRGPWRFRIGRFNCFK 41 >gb|EFW13470.1| hypothetical protein CPSG_09922 [Coccidioides posadasii str. Silveira] Length = 115 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = +2 Query: 362 MPFLWTKNVGGKHAGAGITVDRHGVRRNPFRFSLGKLNCFR 484 MPF ++K GG+H GITV RHGVRR P+ F LGK CFR Sbjct: 75 MPFFYSKRFGGRHISTGITVSRHGVRRQPWGFRLGKCLCFR 115 >gb|EFQ25271.1| hypothetical protein GLRG_00415 [Colletotrichum graminicola M1.001] gi|380492913|emb|CCF34259.1| hypothetical protein CH063_06291 [Colletotrichum higginsianum] Length = 41 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/41 (51%), Positives = 31/41 (75%) Frame = +2 Query: 362 MPFLWTKNVGGKHAGAGITVDRHGVRRNPFRFSLGKLNCFR 484 MPF ++K +GG++ G + DRHGVRR P+RF +G+ +CFR Sbjct: 1 MPFFYSKPIGGRNFGTSVHADRHGVRRGPWRFRIGRFHCFR 41