BLASTX nr result
ID: Akebia25_contig00047141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00047141 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOA86408.1| hypothetical protein SETTUDRAFT_169171 [Setosphae... 60 3e-07 >gb|EOA86408.1| hypothetical protein SETTUDRAFT_169171 [Setosphaeria turcica Et28A] Length = 537 Score = 60.1 bits (144), Expect = 3e-07 Identities = 35/68 (51%), Positives = 43/68 (63%), Gaps = 1/68 (1%) Frame = -1 Query: 357 HSSTIQPEFWSLAHGKSNGHRHDEPGTEDESCREEDTGSEGSPSGEQDGP-GCLLDCSDE 181 HSSTIQPEF A+ H H G+ DES E+ G+ +PS +DGP CLL+CSD Sbjct: 466 HSSTIQPEFCLDAN-----HDHSAQGS-DESGAEDTAGTSKNPS-VRDGPDACLLECSDT 518 Query: 180 CGEGEQCC 157 CG G+QCC Sbjct: 519 CGGGKQCC 526