BLASTX nr result
ID: Akebia25_contig00047061
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00047061 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302439.1| hypothetical protein POPTR_0002s12860g [Popu... 56 5e-06 >ref|XP_002302439.1| hypothetical protein POPTR_0002s12860g [Populus trichocarpa] gi|222844165|gb|EEE81712.1| hypothetical protein POPTR_0002s12860g [Populus trichocarpa] Length = 316 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/53 (50%), Positives = 35/53 (66%) Frame = -1 Query: 172 FAIDLSPADDIFFHGXXXXXXXXXXXXXXXXXSTNSFENFSIPIKDLSEDRKP 14 FAIDLSPADDIFFHG STNSF++F++PIK+L +D++P Sbjct: 79 FAIDLSPADDIFFHGHLLPLHLLSHLPVSPRSSTNSFDSFTLPIKELLDDQRP 131