BLASTX nr result
ID: Akebia25_contig00046566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00046566 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006494918.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin th... 64 3e-08 ref|XP_006420758.1| hypothetical protein CICLE_v10005352mg [Citr... 64 3e-08 ref|XP_007223296.1| hypothetical protein PRUPE_ppa007269mg [Prun... 64 3e-08 ref|NP_001137084.1| hypothetical protein [Zea mays] gi|194698282... 62 6e-08 ref|XP_006844468.1| hypothetical protein AMTR_s00016p00097180 [A... 62 1e-07 ref|XP_007043792.1| Ubiquitin thioesterase otubain-like isoform ... 61 1e-07 ref|XP_007043790.1| Otubain, Ubiquitin thioesterase Otubain, Pep... 61 1e-07 ref|XP_007043788.1| Ubiquitin thioesterase otubain-like isoform ... 61 1e-07 ref|XP_007043787.1| Ubiquitin thioesterase otubain-like isoform ... 61 1e-07 ref|XP_007043785.1| Otubain, Ubiquitin thioesterase Otubain, Pep... 61 1e-07 ref|XP_002534741.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|XP_007148266.1| hypothetical protein PHAVU_006G193900g [Phas... 61 2e-07 ref|XP_002299353.2| hypothetical protein POPTR_0001s13020g [Popu... 61 2e-07 ref|XP_003545805.1| PREDICTED: ubiquitin thioesterase otubain-li... 61 2e-07 ref|NP_001242120.1| uncharacterized protein LOC100787261 [Glycin... 61 2e-07 gb|ABU93349.1| otubain-like cysteine protease [Populus trichocarpa] 61 2e-07 ref|XP_006420760.1| hypothetical protein CICLE_v10005352mg [Citr... 60 3e-07 ref|XP_004485686.1| PREDICTED: ubiquitin thioesterase otubain-li... 60 3e-07 emb|CBI29258.3| unnamed protein product [Vitis vinifera] 60 3e-07 ref|XP_002270583.1| PREDICTED: ubiquitin thioesterase otubain-li... 60 3e-07 >ref|XP_006494918.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin thioesterase otubain-like [Citrus sinensis] Length = 300 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIKVLGE YAAIRRTRGDGNCFFR FMFSYL Sbjct: 65 KIKVLGEQYAAIRRTRGDGNCFFRSFMFSYL 95 >ref|XP_006420758.1| hypothetical protein CICLE_v10005352mg [Citrus clementina] gi|567855279|ref|XP_006420759.1| hypothetical protein CICLE_v10005352mg [Citrus clementina] gi|557522631|gb|ESR33998.1| hypothetical protein CICLE_v10005352mg [Citrus clementina] gi|557522632|gb|ESR33999.1| hypothetical protein CICLE_v10005352mg [Citrus clementina] Length = 341 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIKVLGE YAAIRRTRGDGNCFFR FMFSYL Sbjct: 114 KIKVLGEQYAAIRRTRGDGNCFFRSFMFSYL 144 >ref|XP_007223296.1| hypothetical protein PRUPE_ppa007269mg [Prunus persica] gi|462420232|gb|EMJ24495.1| hypothetical protein PRUPE_ppa007269mg [Prunus persica] Length = 375 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIKVLGE YAAIRRTRGDGNCFFR FMFSYL Sbjct: 149 KIKVLGEQYAAIRRTRGDGNCFFRSFMFSYL 179 >ref|NP_001137084.1| hypothetical protein [Zea mays] gi|194698282|gb|ACF83225.1| unknown [Zea mays] gi|413921696|gb|AFW61628.1| hypothetical protein ZEAMMB73_718185 [Zea mays] Length = 140 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYLVLS 156 KIK+LGE Y A+RRTRGDGNCF+R FMFSYLV+S Sbjct: 89 KIKLLGEQYGALRRTRGDGNCFYRSFMFSYLVVS 122 >ref|XP_006844468.1| hypothetical protein AMTR_s00016p00097180 [Amborella trichopoda] gi|548846939|gb|ERN06143.1| hypothetical protein AMTR_s00016p00097180 [Amborella trichopoda] Length = 340 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIK+L E YAAIRRTRGDGNCFFRCF+F+YL Sbjct: 123 KIKILEEKYAAIRRTRGDGNCFFRCFLFAYL 153 >ref|XP_007043792.1| Ubiquitin thioesterase otubain-like isoform 8 [Theobroma cacao] gi|508707727|gb|EOX99623.1| Ubiquitin thioesterase otubain-like isoform 8 [Theobroma cacao] Length = 228 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIK+LG+ YAAIRRTRGDGNCFFR FMFSYL Sbjct: 76 KIKLLGQQYAAIRRTRGDGNCFFRSFMFSYL 106 >ref|XP_007043790.1| Otubain, Ubiquitin thioesterase Otubain, Peptidase C65, otubain isoform 6 [Theobroma cacao] gi|508707725|gb|EOX99621.1| Otubain, Ubiquitin thioesterase Otubain, Peptidase C65, otubain isoform 6 [Theobroma cacao] Length = 268 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIK+LG+ YAAIRRTRGDGNCFFR FMFSYL Sbjct: 41 KIKLLGQQYAAIRRTRGDGNCFFRSFMFSYL 71 >ref|XP_007043788.1| Ubiquitin thioesterase otubain-like isoform 4, partial [Theobroma cacao] gi|508707723|gb|EOX99619.1| Ubiquitin thioesterase otubain-like isoform 4, partial [Theobroma cacao] Length = 335 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIK+LG+ YAAIRRTRGDGNCFFR FMFSYL Sbjct: 108 KIKLLGQQYAAIRRTRGDGNCFFRSFMFSYL 138 >ref|XP_007043787.1| Ubiquitin thioesterase otubain-like isoform 3, partial [Theobroma cacao] gi|508707722|gb|EOX99618.1| Ubiquitin thioesterase otubain-like isoform 3, partial [Theobroma cacao] Length = 322 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIK+LG+ YAAIRRTRGDGNCFFR FMFSYL Sbjct: 95 KIKLLGQQYAAIRRTRGDGNCFFRSFMFSYL 125 >ref|XP_007043785.1| Otubain, Ubiquitin thioesterase Otubain, Peptidase C65, otubain isoform 1 [Theobroma cacao] gi|590691448|ref|XP_007043786.1| Otubain, Ubiquitin thioesterase Otubain, Peptidase C65, otubain isoform 1 [Theobroma cacao] gi|590691458|ref|XP_007043789.1| Otubain, Ubiquitin thioesterase Otubain, Peptidase C65, otubain isoform 1 [Theobroma cacao] gi|590691465|ref|XP_007043791.1| Otubain, Ubiquitin thioesterase Otubain, Peptidase C65, otubain isoform 1 [Theobroma cacao] gi|508707720|gb|EOX99616.1| Otubain, Ubiquitin thioesterase Otubain, Peptidase C65, otubain isoform 1 [Theobroma cacao] gi|508707721|gb|EOX99617.1| Otubain, Ubiquitin thioesterase Otubain, Peptidase C65, otubain isoform 1 [Theobroma cacao] gi|508707724|gb|EOX99620.1| Otubain, Ubiquitin thioesterase Otubain, Peptidase C65, otubain isoform 1 [Theobroma cacao] gi|508707726|gb|EOX99622.1| Otubain, Ubiquitin thioesterase Otubain, Peptidase C65, otubain isoform 1 [Theobroma cacao] Length = 303 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIK+LG+ YAAIRRTRGDGNCFFR FMFSYL Sbjct: 76 KIKLLGQQYAAIRRTRGDGNCFFRSFMFSYL 106 >ref|XP_002534741.1| conserved hypothetical protein [Ricinus communis] gi|223524648|gb|EEF27640.1| conserved hypothetical protein [Ricinus communis] Length = 304 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIKVLGE Y AIRRTRGDGNCFFR FMFSYL Sbjct: 77 KIKVLGEQYDAIRRTRGDGNCFFRSFMFSYL 107 >ref|XP_007148266.1| hypothetical protein PHAVU_006G193900g [Phaseolus vulgaris] gi|561021489|gb|ESW20260.1| hypothetical protein PHAVU_006G193900g [Phaseolus vulgaris] Length = 303 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIKVL E YAAIRRTRGDGNCFFR FMFSYL Sbjct: 76 KIKVLDEQYAAIRRTRGDGNCFFRSFMFSYL 106 >ref|XP_002299353.2| hypothetical protein POPTR_0001s13020g [Populus trichocarpa] gi|550347135|gb|EEE84158.2| hypothetical protein POPTR_0001s13020g [Populus trichocarpa] Length = 285 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIKVLG+ Y AIRRTRGDGNCFFR FMFSYL Sbjct: 58 KIKVLGDKYVAIRRTRGDGNCFFRSFMFSYL 88 >ref|XP_003545805.1| PREDICTED: ubiquitin thioesterase otubain-like [Glycine max] Length = 301 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIKVL E YAAIRRTRGDGNCFFR FMFSYL Sbjct: 75 KIKVLDEQYAAIRRTRGDGNCFFRSFMFSYL 105 >ref|NP_001242120.1| uncharacterized protein LOC100787261 [Glycine max] gi|255640197|gb|ACU20389.1| unknown [Glycine max] Length = 301 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIKVL E YAAIRRTRGDGNCFFR FMFSYL Sbjct: 75 KIKVLDEQYAAIRRTRGDGNCFFRSFMFSYL 105 >gb|ABU93349.1| otubain-like cysteine protease [Populus trichocarpa] Length = 260 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIKVLG+ Y AIRRTRGDGNCFFR FMFSYL Sbjct: 33 KIKVLGDKYVAIRRTRGDGNCFFRSFMFSYL 63 >ref|XP_006420760.1| hypothetical protein CICLE_v10005352mg [Citrus clementina] gi|557522633|gb|ESR34000.1| hypothetical protein CICLE_v10005352mg [Citrus clementina] Length = 319 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 251 KVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KVLGE YAAIRRTRGDGNCFFR FMFSYL Sbjct: 94 KVLGEQYAAIRRTRGDGNCFFRSFMFSYL 122 >ref|XP_004485686.1| PREDICTED: ubiquitin thioesterase otubain-like [Cicer arietinum] Length = 298 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIKVL E YAAIRRTRGDGNCFFR FMFSYL Sbjct: 70 KIKVLDEQYAAIRRTRGDGNCFFRGFMFSYL 100 >emb|CBI29258.3| unnamed protein product [Vitis vinifera] Length = 305 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIKVLGE Y +IRRTRGDGNCFFR FMFSYL Sbjct: 76 KIKVLGEKYGSIRRTRGDGNCFFRGFMFSYL 106 >ref|XP_002270583.1| PREDICTED: ubiquitin thioesterase otubain-like [Vitis vinifera] Length = 270 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 257 KIKVLGENYAAIRRTRGDGNCFFRCFMFSYL 165 KIKVLGE Y +IRRTRGDGNCFFR FMFSYL Sbjct: 41 KIKVLGEKYGSIRRTRGDGNCFFRGFMFSYL 71