BLASTX nr result
ID: Akebia25_contig00046562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00046562 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME48945.1| hypothetical protein DOTSEDRAFT_67853 [Dothistrom... 113 3e-23 gb|EMC96653.1| hypothetical protein BAUCODRAFT_34032 [Baudoinia ... 113 3e-23 gb|EME89012.1| hypothetical protein MYCFIDRAFT_181407 [Pseudocer... 110 3e-22 gb|EMF16436.1| 40S ribosomal protein S6-B [Sphaerulina musiva SO... 108 6e-22 ref|XP_003852989.1| 40S ribosomal protein S6 [Zymoseptoria triti... 108 8e-22 gb|EXJ95055.1| 40S ribosomal protein S6-A [Capronia coronata CBS... 105 9e-21 gb|ETI27818.1| 40S ribosomal protein S6-B [Cladophialophora carr... 103 2e-20 gb|EHY57703.1| 40S ribosomal protein S6-A [Exophiala dermatitidi... 103 2e-20 gb|EXJ88970.1| 40S ribosomal protein S6-B [Capronia epimyces CBS... 103 3e-20 gb|ETN37663.1| 40S ribosomal protein S6-B [Cyphellophora europae... 103 3e-20 ref|XP_002835429.1| 40S ribosomal protein S6 [Tuber melanosporum... 103 3e-20 gb|EXJ63909.1| 40S ribosomal protein S6-B [Cladophialophora yegr... 102 6e-20 gb|EOA90996.1| hypothetical protein SETTUDRAFT_102110 [Setosphae... 102 6e-20 gb|EXJ72915.1| 40S ribosomal protein S6-B [Cladophialophora psam... 101 1e-19 ref|XP_001935910.1| 40S ribosomal protein S6 [Pyrenophora tritic... 101 1e-19 ref|XP_003306964.1| 40S ribosomal protein S6 [Pyrenophora teres ... 100 2e-19 ref|XP_003836586.1| hypothetical protein LEMA_P041220.1 [Leptosp... 100 2e-19 gb|EMD96068.1| hypothetical protein COCHEDRAFT_1166905 [Bipolari... 99 6e-19 ref|XP_001797870.1| hypothetical protein SNOG_07535 [Phaeosphaer... 99 6e-19 gb|EUC42499.1| hypothetical protein COCMIDRAFT_103365 [Bipolaris... 98 1e-18 >gb|EME48945.1| hypothetical protein DOTSEDRAFT_67853 [Dothistroma septosporum NZE10] Length = 241 Score = 113 bits (282), Expect = 3e-23 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEKDKQAE 182 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRR AEASKDAANEYA+VLHKRV+EEK KQAE Sbjct: 171 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRHAEASKDAANEYAQVLHKRVNEEKAKQAE 230 >gb|EMC96653.1| hypothetical protein BAUCODRAFT_34032 [Baudoinia compniacensis UAMH 10762] Length = 239 Score = 113 bits (282), Expect = 3e-23 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEKDKQAE 182 AKPYTKAPRIQRLVTPQRLQHKRHRIA+KRRRAEASKDAANEYA++LHKRV EEK KQA+ Sbjct: 169 AKPYTKAPRIQRLVTPQRLQHKRHRIAIKRRRAEASKDAANEYAQILHKRVGEEKQKQAD 228 >gb|EME89012.1| hypothetical protein MYCFIDRAFT_181407 [Pseudocercospora fijiensis CIRAD86] Length = 241 Score = 110 bits (274), Expect = 3e-22 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEKDKQAE 182 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEA+KDAANEYA++LHKRV+EEK K A+ Sbjct: 171 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEAAKDAANEYAQILHKRVAEEKAKAAD 230 >gb|EMF16436.1| 40S ribosomal protein S6-B [Sphaerulina musiva SO2202] Length = 241 Score = 108 bits (271), Expect = 6e-22 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEKDKQAE 182 AK YTKAPRIQRLVTPQRLQHKRHR+ALKRRRAEASKDAANEYA+VLHKRVSEEK K A+ Sbjct: 171 AKAYTKAPRIQRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQVLHKRVSEEKAKVAD 230 >ref|XP_003852989.1| 40S ribosomal protein S6 [Zymoseptoria tritici IPO323] gi|339472871|gb|EGP87965.1| hypothetical protein MYCGRDRAFT_104155 [Zymoseptoria tritici IPO323] Length = 241 Score = 108 bits (270), Expect = 8e-22 Identities = 53/60 (88%), Positives = 57/60 (95%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEKDKQAE 182 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRR+AE K+AANEYA+VLHKRV+EEK KQAE Sbjct: 171 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRQAEKVKEAANEYAQVLHKRVNEEKSKQAE 230 >gb|EXJ95055.1| 40S ribosomal protein S6-A [Capronia coronata CBS 617.96] Length = 239 Score = 105 bits (261), Expect = 9e-21 Identities = 50/60 (83%), Positives = 57/60 (95%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEKDKQAE 182 AKPYTKAP+IQRLVTPQR+QHKRHRIALKRRRAEA+KDAANEYA++L KRV EE+DK+ E Sbjct: 169 AKPYTKAPKIQRLVTPQRMQHKRHRIALKRRRAEAAKDAANEYAQLLAKRVHEERDKRTE 228 >gb|ETI27818.1| 40S ribosomal protein S6-B [Cladophialophora carrionii CBS 160.54] Length = 239 Score = 103 bits (257), Expect = 2e-20 Identities = 49/60 (81%), Positives = 57/60 (95%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEKDKQAE 182 AKPYTKAP+IQRLVTPQR+QHKRHRIALKRRRAEA+KDAANEYA++L KRV EE++K+ E Sbjct: 169 AKPYTKAPKIQRLVTPQRMQHKRHRIALKRRRAEAAKDAANEYAQLLAKRVHEEREKRTE 228 >gb|EHY57703.1| 40S ribosomal protein S6-A [Exophiala dermatitidis NIH/UT8656] Length = 239 Score = 103 bits (257), Expect = 2e-20 Identities = 49/60 (81%), Positives = 57/60 (95%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEKDKQAE 182 AKPYTKAP+IQRLVTPQR+QHKRHRIALKRRRAEA+KDAANEYA++L KRV EE++K+ E Sbjct: 169 AKPYTKAPKIQRLVTPQRMQHKRHRIALKRRRAEAAKDAANEYAQLLAKRVHEEREKRTE 228 >gb|EXJ88970.1| 40S ribosomal protein S6-B [Capronia epimyces CBS 606.96] Length = 239 Score = 103 bits (256), Expect = 3e-20 Identities = 49/60 (81%), Positives = 57/60 (95%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEKDKQAE 182 AKPYTKAP+IQRLVTPQRLQHKRHRIALKRRRAEA+KDAANEY+++L KRV EE++K+ E Sbjct: 169 AKPYTKAPKIQRLVTPQRLQHKRHRIALKRRRAEAAKDAANEYSQLLAKRVHEEREKRTE 228 >gb|ETN37663.1| 40S ribosomal protein S6-B [Cyphellophora europaea CBS 101466] Length = 243 Score = 103 bits (256), Expect = 3e-20 Identities = 48/60 (80%), Positives = 58/60 (96%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEKDKQAE 182 AKPYTKAP+IQRLVTPQR+QHKRHR+ALKRRRAEASKDAANEY+++L KRV EE++K++E Sbjct: 173 AKPYTKAPKIQRLVTPQRMQHKRHRLALKRRRAEASKDAANEYSQLLAKRVHEEREKKSE 232 >ref|XP_002835429.1| 40S ribosomal protein S6 [Tuber melanosporum Mel28] gi|295629210|emb|CAZ79586.1| unnamed protein product [Tuber melanosporum] Length = 214 Score = 103 bits (256), Expect = 3e-20 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +3 Query: 6 KPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEKDKQAE 182 KPYTKAP+IQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYA +L KRV EEK K++E Sbjct: 139 KPYTKAPKIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAALLAKRVHEEKAKRSE 197 >gb|EXJ63909.1| 40S ribosomal protein S6-B [Cladophialophora yegresii CBS 114405] Length = 239 Score = 102 bits (254), Expect = 6e-20 Identities = 48/60 (80%), Positives = 57/60 (95%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEKDKQAE 182 AKPYTKAP+IQRLVTPQR+QHKRHRIALKRRRAEA+KDAAN+YA++L KRV EE++K+ E Sbjct: 169 AKPYTKAPKIQRLVTPQRMQHKRHRIALKRRRAEAAKDAANDYAQLLAKRVHEEREKRTE 228 >gb|EOA90996.1| hypothetical protein SETTUDRAFT_102110 [Setosphaeria turcica Et28A] Length = 239 Score = 102 bits (254), Expect = 6e-20 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEK 167 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYA++L KR+SE K Sbjct: 169 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAQILSKRMSEAK 223 >gb|EXJ72915.1| 40S ribosomal protein S6-B [Cladophialophora psammophila CBS 110553] Length = 240 Score = 101 bits (251), Expect = 1e-19 Identities = 48/60 (80%), Positives = 56/60 (93%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEKDKQAE 182 AKPYTKAP+IQRLVTPQR+QHKRHRIALKRRRAEA+KDAANEY ++L KRV EE++K+ E Sbjct: 169 AKPYTKAPKIQRLVTPQRMQHKRHRIALKRRRAEAAKDAANEYHQLLAKRVHEEREKRTE 228 >ref|XP_001935910.1| 40S ribosomal protein S6 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983009|gb|EDU48497.1| 40S ribosomal protein S6-B [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 239 Score = 101 bits (251), Expect = 1e-19 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEK 167 AKPYTKAP+IQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYA++L KR++E K Sbjct: 169 AKPYTKAPKIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAQILSKRINESK 223 >ref|XP_003306964.1| 40S ribosomal protein S6 [Pyrenophora teres f. teres 0-1] gi|311315235|gb|EFQ84937.1| hypothetical protein PTT_20282 [Pyrenophora teres f. teres 0-1] Length = 239 Score = 100 bits (250), Expect = 2e-19 Identities = 47/55 (85%), Positives = 53/55 (96%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEK 167 AKPYTKAP+IQRLVTPQRLQHKRHR+ALKRRRAEASKDAANEYA++L KR++E K Sbjct: 169 AKPYTKAPKIQRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILSKRINESK 223 >ref|XP_003836586.1| hypothetical protein LEMA_P041220.1 [Leptosphaeria maculans JN3] gi|312213139|emb|CBX93221.1| hypothetical protein LEMA_P041220.1 [Leptosphaeria maculans JN3] Length = 313 Score = 100 bits (249), Expect = 2e-19 Identities = 47/55 (85%), Positives = 53/55 (96%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEK 167 AKPYTKAP+IQRLVTPQRLQHKRHR+ALKRRRAEASKDAANEYA++L KR+S+ K Sbjct: 243 AKPYTKAPKIQRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILSKRISDAK 297 >gb|EMD96068.1| hypothetical protein COCHEDRAFT_1166905 [Bipolaris maydis C5] gi|477593859|gb|ENI10928.1| hypothetical protein COCC4DRAFT_46559 [Bipolaris maydis ATCC 48331] gi|576924864|gb|EUC38971.1| hypothetical protein COCCADRAFT_21712 [Bipolaris zeicola 26-R-13] gi|578485559|gb|EUN23053.1| hypothetical protein COCVIDRAFT_109868 [Bipolaris victoriae FI3] Length = 239 Score = 99.0 bits (245), Expect = 6e-19 Identities = 46/55 (83%), Positives = 53/55 (96%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEK 167 AKPYTKAP+IQRLVTPQRLQHKRHR+ALKRRRAEASKDAANEYA++L KR+++ K Sbjct: 169 AKPYTKAPKIQRLVTPQRLQHKRHRLALKRRRAEASKDAANEYAQILSKRINDAK 223 >ref|XP_001797870.1| hypothetical protein SNOG_07535 [Phaeosphaeria nodorum SN15] gi|111063881|gb|EAT85001.1| hypothetical protein SNOG_07535 [Phaeosphaeria nodorum SN15] Length = 239 Score = 99.0 bits (245), Expect = 6e-19 Identities = 47/55 (85%), Positives = 52/55 (94%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEK 167 AKPYTKAP+IQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYA++L KR+ + K Sbjct: 169 AKPYTKAPKIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAQILQKRLGQAK 223 >gb|EUC42499.1| hypothetical protein COCMIDRAFT_103365 [Bipolaris oryzae ATCC 44560] Length = 239 Score = 97.8 bits (242), Expect = 1e-18 Identities = 45/55 (81%), Positives = 53/55 (96%) Frame = +3 Query: 3 AKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAKVLHKRVSEEK 167 A+PYTKAP+IQRLVTPQRLQHKRHR+ALKRRRAEASKDAANEYA++L KR+++ K Sbjct: 169 ARPYTKAPKIQRLVTPQRLQHKRHRLALKRRRAEASKDAANEYAQILSKRINDAK 223