BLASTX nr result
ID: Akebia25_contig00046537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00046537 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007018351.1| Nbs-lrr resistance protein, putative [Theobr... 55 8e-06 >ref|XP_007018351.1| Nbs-lrr resistance protein, putative [Theobroma cacao] gi|508723679|gb|EOY15576.1| Nbs-lrr resistance protein, putative [Theobroma cacao] Length = 1163 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/66 (39%), Positives = 40/66 (60%), Gaps = 6/66 (9%) Frame = -3 Query: 262 NEYIEDMVGRCLFQDEKRDEDGRIVKFKMHAVVHDLALYVAGKEYSQTINSN------AT 101 NEY +D+V FQD ++ E+G I++ KMH ++HDLA + G E++ N N T Sbjct: 462 NEYFDDLVWMFFFQDIQKSENGNIIECKMHDLIHDLAQSIVGNEFNMLENDNIREDLCQT 521 Query: 100 RHLSLI 83 RH S++ Sbjct: 522 RHSSVV 527