BLASTX nr result
ID: Akebia25_contig00046514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00046514 (299 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME78299.1| hypothetical protein MYCFIDRAFT_190637 [Pseudocer... 61 1e-07 gb|EMF09542.1| ras-domain-containing protein [Sphaerulina musiva... 59 7e-07 gb|EME40844.1| hypothetical protein DOTSEDRAFT_178065 [Dothistro... 55 8e-06 >gb|EME78299.1| hypothetical protein MYCFIDRAFT_190637 [Pseudocercospora fijiensis CIRAD86] Length = 207 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/47 (59%), Positives = 32/47 (68%) Frame = +1 Query: 4 GLNVKDLFTMIALTLPGMESEAQPPPSRTLDVDINAQKEPETGGCNC 144 G NVK LF IA LPGME E Q P+ T+DV++NAQK GGCNC Sbjct: 161 GHNVKGLFKKIAQALPGMEGEGQQGPANTIDVNVNAQKPESEGGCNC 207 >gb|EMF09542.1| ras-domain-containing protein [Sphaerulina musiva SO2202] Length = 207 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/47 (57%), Positives = 31/47 (65%) Frame = +1 Query: 4 GLNVKDLFTMIALTLPGMESEAQPPPSRTLDVDINAQKEPETGGCNC 144 G NVK LF IA LPGME E Q P+ T+DV++NA K GGCNC Sbjct: 161 GHNVKGLFKKIAQALPGMEGEGQQGPANTIDVNVNAAKPESEGGCNC 207 >gb|EME40844.1| hypothetical protein DOTSEDRAFT_178065 [Dothistroma septosporum NZE10] Length = 207 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/47 (55%), Positives = 30/47 (63%) Frame = +1 Query: 4 GLNVKDLFTMIALTLPGMESEAQPPPSRTLDVDINAQKEPETGGCNC 144 G NVK LF IA LPGME E Q + T+DV++NA K GGCNC Sbjct: 161 GHNVKGLFKKIAQALPGMEGEGQQGVANTIDVNVNAPKPESEGGCNC 207