BLASTX nr result
ID: Akebia25_contig00046489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00046489 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69109.1| hypothetical protein VITISV_025716 [Vitis vinifera] 57 3e-06 emb|CAN64135.1| hypothetical protein VITISV_033516 [Vitis vinifera] 55 8e-06 >emb|CAN69109.1| hypothetical protein VITISV_025716 [Vitis vinifera] Length = 1241 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/77 (37%), Positives = 41/77 (53%) Frame = +1 Query: 49 GVILTVDNLITRGEFLLLFCSLCKASRESTNHLLIHCVFSYAFLFHFIHLFNLRWCFPCS 228 G I TVD L+ RG ++ CSLCK + ES +H+LIHC + F + F + W FP S Sbjct: 624 GKISTVDMLMRRGWSMVNRCSLCKENEESADHILIHCGXTREFWTLLLSSFGVXWVFPAS 683 Query: 229 IYAKFHGWQSVALNLEK 279 + W+ L +K Sbjct: 684 VRNLLLEWKVKGLGTKK 700 >emb|CAN64135.1| hypothetical protein VITISV_033516 [Vitis vinifera] Length = 177 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/77 (37%), Positives = 39/77 (50%) Frame = +1 Query: 22 CFLHLVSFHGVILTVDNLITRGEFLLLFCSLCKASRESTNHLLIHCVFSYAFLFHFIHLF 201 CF + G LT+D + RG L C LC ++ ES +HLL+HCV + A F LF Sbjct: 49 CFFAWEASWGKALTLDQIQKRGWALPNRCYLCHSNEESIDHLLLHCVKTRALWEVFFSLF 108 Query: 202 NLRWCFPCSIYAKFHGW 252 + W FP S+ W Sbjct: 109 GVLWVFPSSVKETLLSW 125