BLASTX nr result
ID: Akebia25_contig00046462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00046462 (667 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAA95983.1| hypothetical protein E5Q_02641 [Mixia osmundae I... 72 2e-10 gb|EMS23251.1| hypothetical protein RHTO_07593 [Rhodosporidium t... 58 3e-06 >dbj|GAA95983.1| hypothetical protein E5Q_02641 [Mixia osmundae IAM 14324] Length = 344 Score = 71.6 bits (174), Expect = 2e-10 Identities = 31/71 (43%), Positives = 43/71 (60%) Frame = -3 Query: 215 RNAEERCLYGQCTYQCGDGYHKIAGKCFKNQNTCDGKRCAPIQNGDTFCGGDNQCVYRCD 36 ++AE C +G+C++ C GY+K G+C K + CD K C PI NG + C N C Y CD Sbjct: 216 KHAEPYCHHGKCSFTCKTGYYKKNGQCHKGDDKCD-KACKPITNGASKCSKKNGCTYYCD 274 Query: 35 QAQGFTLYTNS 3 A GF+L+ S Sbjct: 275 TANGFSLHKTS 285 >gb|EMS23251.1| hypothetical protein RHTO_07593 [Rhodosporidium toruloides NP11] Length = 340 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/87 (32%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = -3 Query: 260 CDTDSDCSGKVRFLPRNAEERCLYGQCTYQCGDGYHKIAG---KCFKNQNTCDGKRCAPI 90 C +D C+ + +P NA RC+ G+CT++C G+ +C +++C G +C Sbjct: 180 CGSDGVCASRGPAVPANAAARCISGKCTFRCNSGFAPGGADGTQCVATESSCGGVQCTVP 239 Query: 89 QNGDTFCGGDNQCVYRCDQAQGFTLYT 9 NG + C G CV C+ QG+T Y+ Sbjct: 240 ANGYSTCSG-GACVVGCN--QGYTRYS 263