BLASTX nr result
ID: Akebia25_contig00046428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00046428 (617 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001224669.1| hypothetical protein CHGG_07013 [Chaetomium ... 59 1e-06 gb|EMR61386.1| putative zinc knuckle domain-containing protein [... 59 1e-06 gb|ERS99399.1| hypothetical protein HMPREF1624_04599 [Sporothrix... 58 3e-06 gb|ELQ40888.1| zinc knuckle domain-containing protein [Magnaport... 58 3e-06 gb|EFX03302.1| zinc knuckle domain containing protein [Grosmanni... 58 3e-06 ref|XP_003711783.1| zinc knuckle domain-containing protein [Magn... 58 3e-06 gb|ETS81336.1| hypothetical protein PFICI_06338 [Pestalotiopsis ... 57 3e-06 gb|EQB46675.1| zinc knuckle [Colletotrichum gloeosporioides Cg-14] 57 4e-06 gb|ENH76452.1| zinc knuckle domain protein [Colletotrichum orbic... 57 4e-06 ref|XP_007286325.1| zinc knuckle domain protein [Colletotrichum ... 57 4e-06 emb|CCF41183.1| cellular nucleic acid-binding protein [Colletotr... 57 4e-06 gb|EFQ32315.1| zinc knuckle [Colletotrichum graminicola M1.001] 57 4e-06 ref|XP_001912110.1| hypothetical protein [Podospora anserina S m... 56 1e-05 >ref|XP_001224669.1| hypothetical protein CHGG_07013 [Chaetomium globosum CBS 148.51] gi|88178292|gb|EAQ85760.1| hypothetical protein CHGG_07013 [Chaetomium globosum CBS 148.51] Length = 200 Score = 58.9 bits (141), Expect = 1e-06 Identities = 20/33 (60%), Positives = 29/33 (87%) Frame = -1 Query: 617 GHMSRNCTQEQTGGDRMCYKCKQPGHIQADCSN 519 GH+SR+C +E TGG+++CYKC+QPGH+Q+ C N Sbjct: 168 GHVSRDCPKESTGGEKICYKCQQPGHVQSQCPN 200 >gb|EMR61386.1| putative zinc knuckle domain-containing protein [Eutypa lata UCREL1] Length = 197 Score = 58.9 bits (141), Expect = 1e-06 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = -1 Query: 617 GHMSRNCTQEQTGGDRMCYKCKQPGHIQADCSN 519 GH SR+C +E TGG+++CYKC+QPGH+QA C N Sbjct: 165 GHFSRDCPKESTGGEKICYKCQQPGHVQAACPN 197 >gb|ERS99399.1| hypothetical protein HMPREF1624_04599 [Sporothrix schenckii ATCC 58251] Length = 188 Score = 57.8 bits (138), Expect = 3e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -1 Query: 617 GHMSRNCTQEQTGGDRMCYKCKQPGHIQADCSN 519 GH SR+C + T G+++CYKC+QPGHIQADC N Sbjct: 155 GHFSRDCPKASTSGEKICYKCQQPGHIQADCPN 187 >gb|ELQ40888.1| zinc knuckle domain-containing protein [Magnaporthe oryzae Y34] gi|440479225|gb|ELQ60008.1| zinc knuckle domain-containing protein [Magnaporthe oryzae P131] Length = 182 Score = 57.8 bits (138), Expect = 3e-06 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = -1 Query: 617 GHMSRNCTQEQTGGDRMCYKCKQPGHIQADCSN 519 GH SR+C++ T G++MCYKC+QPGH+QA+C N Sbjct: 149 GHFSRDCSKRSTTGEKMCYKCQQPGHVQAECPN 181 >gb|EFX03302.1| zinc knuckle domain containing protein [Grosmannia clavigera kw1407] Length = 190 Score = 57.8 bits (138), Expect = 3e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -1 Query: 617 GHMSRNCTQEQTGGDRMCYKCKQPGHIQADCSN 519 GH SR+C + T G+++CYKC+QPGHIQADC N Sbjct: 157 GHFSRDCPKASTSGEKICYKCQQPGHIQADCPN 189 >ref|XP_003711783.1| zinc knuckle domain-containing protein [Magnaporthe oryzae 70-15] gi|351644115|gb|EHA51976.1| zinc knuckle domain-containing protein [Magnaporthe oryzae 70-15] Length = 199 Score = 57.8 bits (138), Expect = 3e-06 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = -1 Query: 617 GHMSRNCTQEQTGGDRMCYKCKQPGHIQADCSN 519 GH SR+C++ T G++MCYKC+QPGH+QA+C N Sbjct: 166 GHFSRDCSKRSTTGEKMCYKCQQPGHVQAECPN 198 >gb|ETS81336.1| hypothetical protein PFICI_06338 [Pestalotiopsis fici W106-1] Length = 186 Score = 57.4 bits (137), Expect = 3e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -1 Query: 617 GHMSRNCTQEQTGGDRMCYKCKQPGHIQADCSN 519 GH SR+C +E TGG++MCYKC+Q GHIQ+ C N Sbjct: 154 GHFSRDCPKESTGGEKMCYKCQQTGHIQSQCPN 186 >gb|EQB46675.1| zinc knuckle [Colletotrichum gloeosporioides Cg-14] Length = 186 Score = 57.0 bits (136), Expect = 4e-06 Identities = 19/33 (57%), Positives = 28/33 (84%) Frame = -1 Query: 617 GHMSRNCTQEQTGGDRMCYKCKQPGHIQADCSN 519 GH SR+C +E +GG+++CYKC+QPGH+Q+ C N Sbjct: 154 GHFSRDCPKESSGGEKICYKCQQPGHVQSQCPN 186 >gb|ENH76452.1| zinc knuckle domain protein [Colletotrichum orbiculare MAFF 240422] Length = 188 Score = 57.0 bits (136), Expect = 4e-06 Identities = 19/33 (57%), Positives = 28/33 (84%) Frame = -1 Query: 617 GHMSRNCTQEQTGGDRMCYKCKQPGHIQADCSN 519 GH SR+C +E +GG+++CYKC+QPGH+Q+ C N Sbjct: 155 GHFSRDCPKESSGGEKICYKCQQPGHVQSQCPN 187 >ref|XP_007286325.1| zinc knuckle domain protein [Colletotrichum gloeosporioides Nara gc5] gi|429849218|gb|ELA24622.1| zinc knuckle domain protein [Colletotrichum gloeosporioides Nara gc5] Length = 185 Score = 57.0 bits (136), Expect = 4e-06 Identities = 19/33 (57%), Positives = 28/33 (84%) Frame = -1 Query: 617 GHMSRNCTQEQTGGDRMCYKCKQPGHIQADCSN 519 GH SR+C +E +GG+++CYKC+QPGH+Q+ C N Sbjct: 153 GHFSRDCPKESSGGEKICYKCQQPGHVQSQCPN 185 >emb|CCF41183.1| cellular nucleic acid-binding protein [Colletotrichum higginsianum] Length = 51 Score = 57.0 bits (136), Expect = 4e-06 Identities = 19/33 (57%), Positives = 28/33 (84%) Frame = -1 Query: 617 GHMSRNCTQEQTGGDRMCYKCKQPGHIQADCSN 519 GH SR+C +E +GG+++CYKC+QPGH+Q+ C N Sbjct: 18 GHFSRDCPKESSGGEKICYKCQQPGHVQSQCPN 50 >gb|EFQ32315.1| zinc knuckle [Colletotrichum graminicola M1.001] Length = 182 Score = 57.0 bits (136), Expect = 4e-06 Identities = 19/33 (57%), Positives = 28/33 (84%) Frame = -1 Query: 617 GHMSRNCTQEQTGGDRMCYKCKQPGHIQADCSN 519 GH SR+C +E +GG+++CYKC+QPGH+Q+ C N Sbjct: 149 GHFSRDCPKESSGGEKICYKCQQPGHVQSQCPN 181 >ref|XP_001912110.1| hypothetical protein [Podospora anserina S mat+] gi|170947134|emb|CAP73939.1| unnamed protein product [Podospora anserina S mat+] Length = 145 Score = 55.8 bits (133), Expect = 1e-05 Identities = 19/33 (57%), Positives = 27/33 (81%) Frame = -1 Query: 617 GHMSRNCTQEQTGGDRMCYKCKQPGHIQADCSN 519 GH+SR C +E TGG+++CYKC+Q GH+Q+ C N Sbjct: 111 GHLSRECPKESTGGEKICYKCQQSGHVQSQCPN 143