BLASTX nr result
ID: Akebia25_contig00046380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00046380 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38926.1| Secologanin synthase [Morus notabilis] 65 7e-09 ref|XP_007012677.1| Cytochrome P450, putative [Theobroma cacao] ... 64 2e-08 ref|XP_007204041.1| hypothetical protein PRUPE_ppa021108mg [Prun... 64 2e-08 ref|XP_002516294.1| cytochrome P450, putative [Ricinus communis]... 62 8e-08 ref|XP_004144024.1| PREDICTED: secologanin synthase-like [Cucumi... 61 1e-07 ref|XP_004287619.1| PREDICTED: secologanin synthase-like [Fragar... 60 2e-07 ref|XP_003633108.1| PREDICTED: LOW QUALITY PROTEIN: secologanin ... 60 2e-07 emb|CBI27824.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_007035043.1| Cytochrome P450, putative [Theobroma cacao] ... 59 5e-07 ref|XP_003635295.1| PREDICTED: secologanin synthase-like [Vitis ... 59 5e-07 emb|CAN60851.1| hypothetical protein VITISV_030623 [Vitis vinifera] 59 5e-07 ref|XP_006433419.1| hypothetical protein CICLE_v10003399mg [Citr... 59 9e-07 gb|EXB74885.1| Secologanin synthase [Morus notabilis] 58 1e-06 ref|XP_007043676.1| Cytochrome P450, putative [Theobroma cacao] ... 58 1e-06 ref|XP_004171842.1| PREDICTED: LOW QUALITY PROTEIN: secologanin ... 58 1e-06 ref|XP_004135800.1| PREDICTED: secologanin synthase-like [Cucumi... 58 1e-06 gb|ACV88396.1| cytochrome p450 monoxygenase [Cucumis sativus] 58 1e-06 ref|XP_002458197.1| hypothetical protein SORBIDRAFT_03g028593 [S... 58 1e-06 ref|XP_006830577.1| hypothetical protein AMTR_s00117p00134960 [A... 57 2e-06 ref|XP_002281332.1| PREDICTED: secologanin synthase [Vitis vinif... 57 2e-06 >gb|EXB38926.1| Secologanin synthase [Morus notabilis] Length = 446 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 HF+ EL PSY HAPYTVMTLQPQHGAQIILHQL Sbjct: 414 HFSLELSPSYAHAPYTVMTLQPQHGAQIILHQL 446 >ref|XP_007012677.1| Cytochrome P450, putative [Theobroma cacao] gi|508783040|gb|EOY30296.1| Cytochrome P450, putative [Theobroma cacao] Length = 549 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 HF+F+L PSY+HAPYTVMTLQPQHGA IILHQ+ Sbjct: 517 HFSFKLSPSYSHAPYTVMTLQPQHGAHIILHQI 549 >ref|XP_007204041.1| hypothetical protein PRUPE_ppa021108mg [Prunus persica] gi|462399572|gb|EMJ05240.1| hypothetical protein PRUPE_ppa021108mg [Prunus persica] Length = 503 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 HF+FEL PSYTHAPYTV LQPQHGAQI+LHQL Sbjct: 471 HFSFELSPSYTHAPYTVTILQPQHGAQIMLHQL 503 >ref|XP_002516294.1| cytochrome P450, putative [Ricinus communis] gi|223544780|gb|EEF46296.1| cytochrome P450, putative [Ricinus communis] Length = 488 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 HF+FEL PSY HAPYTVMTLQPQ GAQ+I+HQ+ Sbjct: 456 HFSFELSPSYAHAPYTVMTLQPQRGAQLIIHQV 488 >ref|XP_004144024.1| PREDICTED: secologanin synthase-like [Cucumis sativus] gi|449500470|ref|XP_004161105.1| PREDICTED: secologanin synthase-like [Cucumis sativus] Length = 511 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 +F+F+L PSY HAP+TVMTLQPQHGAQ+ILHQL Sbjct: 479 NFSFQLSPSYAHAPHTVMTLQPQHGAQLILHQL 511 >ref|XP_004287619.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca] Length = 489 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 338 FAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 F+FEL PSYTHAPYT+ LQPQHGAQ+ILHQL Sbjct: 458 FSFELSPSYTHAPYTLTILQPQHGAQVILHQL 489 >ref|XP_003633108.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Vitis vinifera] Length = 520 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 HF+FEL PSYTHAP+TVMTLQPQHGAQ+ +QL Sbjct: 488 HFSFELSPSYTHAPHTVMTLQPQHGAQLKFYQL 520 >emb|CBI27824.3| unnamed protein product [Vitis vinifera] Length = 471 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 HF+FEL PSYTHAP+TVMTLQPQHGAQ+ +QL Sbjct: 439 HFSFELSPSYTHAPHTVMTLQPQHGAQLKFYQL 471 >ref|XP_007035043.1| Cytochrome P450, putative [Theobroma cacao] gi|508714072|gb|EOY05969.1| Cytochrome P450, putative [Theobroma cacao] Length = 511 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 HF FEL PSYTHAP+ V+TLQPQHGA IILHQ+ Sbjct: 479 HFWFELSPSYTHAPHQVITLQPQHGAPIILHQI 511 >ref|XP_003635295.1| PREDICTED: secologanin synthase-like [Vitis vinifera] gi|297741788|emb|CBI33075.3| unnamed protein product [Vitis vinifera] Length = 513 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 HF FEL P+YTHAP+TV+TLQPQHGA IILH++ Sbjct: 481 HFWFELSPTYTHAPHTVITLQPQHGAPIILHEI 513 >emb|CAN60851.1| hypothetical protein VITISV_030623 [Vitis vinifera] Length = 552 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 HF FEL P+YTHAP+TV+TLQPQHGA IILH++ Sbjct: 520 HFWFELSPTYTHAPHTVITLQPQHGAPIILHEI 552 >ref|XP_006433419.1| hypothetical protein CICLE_v10003399mg [Citrus clementina] gi|557535541|gb|ESR46659.1| hypothetical protein CICLE_v10003399mg [Citrus clementina] Length = 454 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 +F+F+L PSY+HAP+TVM LQPQHGAQIILH+L Sbjct: 422 NFSFQLSPSYSHAPHTVMILQPQHGAQIILHKL 454 >gb|EXB74885.1| Secologanin synthase [Morus notabilis] Length = 519 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 HF+FEL PSYTHAP TV+TLQPQ+GA +ILH+L Sbjct: 487 HFSFELSPSYTHAPRTVITLQPQYGAPVILHRL 519 >ref|XP_007043676.1| Cytochrome P450, putative [Theobroma cacao] gi|508707611|gb|EOX99507.1| Cytochrome P450, putative [Theobroma cacao] Length = 510 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 +F+FEL PSYTHAPY +TLQPQ+GAQIILH+L Sbjct: 478 NFSFELSPSYTHAPYAAVTLQPQYGAQIILHKL 510 >ref|XP_004171842.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis sativus] Length = 587 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 HF+FEL PSYTHAP +++T QPQHGA IILH+L Sbjct: 555 HFSFELSPSYTHAPISILTTQPQHGAHIILHKL 587 >ref|XP_004135800.1| PREDICTED: secologanin synthase-like [Cucumis sativus] Length = 521 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 HF+FEL PSYTHAP +++T QPQHGA IILH+L Sbjct: 489 HFSFELSPSYTHAPISILTTQPQHGAHIILHKL 521 >gb|ACV88396.1| cytochrome p450 monoxygenase [Cucumis sativus] Length = 156 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 HF+FEL PSYTHAP +++T QPQHGA IILH+L Sbjct: 124 HFSFELSPSYTHAPISILTTQPQHGAHIILHKL 156 >ref|XP_002458197.1| hypothetical protein SORBIDRAFT_03g028593 [Sorghum bicolor] gi|241930172|gb|EES03317.1| hypothetical protein SORBIDRAFT_03g028593 [Sorghum bicolor] Length = 83 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 HF+FEL PSYTHAPYTV+TL PQHGAQI L +L Sbjct: 51 HFSFELSPSYTHAPYTVITLHPQHGAQIKLTKL 83 >ref|XP_006830577.1| hypothetical protein AMTR_s00117p00134960 [Amborella trichopoda] gi|548837090|gb|ERM97993.1| hypothetical protein AMTR_s00117p00134960 [Amborella trichopoda] Length = 509 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 HF+F L PSYTHAPY +T+QPQHGA IILH+L Sbjct: 477 HFSFHLSPSYTHAPYAQITMQPQHGAPIILHKL 509 >ref|XP_002281332.1| PREDICTED: secologanin synthase [Vitis vinifera] gi|296081714|emb|CBI20719.3| unnamed protein product [Vitis vinifera] Length = 512 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 341 HFAFELLPSYTHAPYTVMTLQPQHGAQIILHQL 243 +F FEL P+YTHAPYTV+TLQPQ+GA IILHQ+ Sbjct: 480 NFWFELSPTYTHAPYTVITLQPQYGAPIILHQI 512