BLASTX nr result
ID: Akebia25_contig00046376
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00046376 (286 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF15042.1| cell division control protein [Sphaerulina musiva... 135 8e-30 gb|EON69709.1| cell division control protein 48 [Coniosporium ap... 132 6e-29 ref|XP_003854896.1| AAA family ATPase CDC48 [Zymoseptoria tritic... 131 8e-29 gb|EME86687.1| hypothetical protein MYCFIDRAFT_151730 [Pseudocer... 130 1e-28 gb|EKG16638.1| ATPase AAA-type VAT [Macrophomina phaseolina MS6] 130 2e-28 gb|EME47715.1| hypothetical protein DOTSEDRAFT_69609 [Dothistrom... 129 4e-28 gb|EMC97874.1| hypothetical protein BAUCODRAFT_31880 [Baudoinia ... 129 5e-28 ref|XP_007587676.1| putative cell division control protein cdc48... 127 2e-27 gb|EXJ84825.1| cell division control protein 48 [Capronia epimyc... 126 3e-27 gb|EXJ94441.1| cell division control protein 48 [Capronia corona... 123 3e-26 gb|EHY59351.1| cell division control protein 48 [Exophiala derma... 122 4e-26 ref|XP_001239786.1| hypothetical protein CIMG_09407 [Coccidioide... 122 5e-26 gb|ETI21065.1| cell division control protein 48 [Cladophialophor... 120 2e-25 ref|XP_003300847.1| hypothetical protein PTT_12208 [Pyrenophora ... 120 3e-25 ref|XP_002340232.1| cell division control protein Cdc48 [Talarom... 119 6e-25 gb|EXJ55503.1| cell division control protein 48 [Cladophialophor... 118 7e-25 gb|EHL00384.1| putative Cell division control protein 48 [Glarea... 117 2e-24 ref|XP_001595101.1| hypothetical protein SS1G_03189 [Sclerotinia... 117 2e-24 gb|ETN41901.1| cell division control protein 48 [Cyphellophora e... 117 2e-24 ref|XP_002145141.1| cell division control protein Cdc48 [Talarom... 117 2e-24 >gb|EMF15042.1| cell division control protein [Sphaerulina musiva SO2202] Length = 826 Score = 135 bits (339), Expect = 8e-30 Identities = 66/79 (83%), Positives = 73/79 (92%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MSAEPDHA SK K KLDNDPSG EK+ ++E ATAIL+KKKKPNSLIVTDATTDDNSI+AL Sbjct: 1 MSAEPDHAASKAKAKLDNDPSGGEKRDENEVATAILKKKKKPNSLIVTDATTDDNSILAL 60 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+TLQLFRGDTVLV+ Sbjct: 61 SNNTMETLQLFRGDTVLVK 79 >gb|EON69709.1| cell division control protein 48 [Coniosporium apollinis CBS 100218] Length = 819 Score = 132 bits (331), Expect = 6e-29 Identities = 64/79 (81%), Positives = 74/79 (93%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MSA+PDH+Q+K KV L +DPSGAEK+ +DETATAILR+KKKPNSLIVTDAT DDNS+IAL Sbjct: 1 MSADPDHSQTKHKVNLSHDPSGAEKRDNDETATAILRRKKKPNSLIVTDATNDDNSVIAL 60 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+TLQLFRGDTVLV+ Sbjct: 61 SNNTMETLQLFRGDTVLVK 79 >ref|XP_003854896.1| AAA family ATPase CDC48 [Zymoseptoria tritici IPO323] gi|339474780|gb|EGP89872.1| hypothetical protein MYCGRDRAFT_55128 [Zymoseptoria tritici IPO323] Length = 822 Score = 131 bits (330), Expect = 8e-29 Identities = 67/79 (84%), Positives = 74/79 (93%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MS EPDHA SKGKVKL NDPSGAEK+ ++ETATAIL+KKKKPNSLIVTDATTDDNSI+AL Sbjct: 1 MSGEPDHAASKGKVKL-NDPSGAEKRDENETATAILKKKKKPNSLIVTDATTDDNSILAL 59 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+ LQLFRGDTVLV+ Sbjct: 60 SNNTMEQLQLFRGDTVLVK 78 >gb|EME86687.1| hypothetical protein MYCFIDRAFT_151730 [Pseudocercospora fijiensis CIRAD86] Length = 826 Score = 130 bits (328), Expect = 1e-28 Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 2/81 (2%) Frame = -2 Query: 237 MSAEPDHAQSKGK--VKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSII 64 MSAEPDH+QSKGK VKLDNDPSG E + +D TATAIL+KKKKPNSL+VTDATTDDNSI+ Sbjct: 1 MSAEPDHSQSKGKGKVKLDNDPSGKEHREEDATATAILKKKKKPNSLLVTDATTDDNSIL 60 Query: 63 ALSNNTMDTLQLFRGDTVLVQ 1 ALSNNTM+ LQLFRGDTVLV+ Sbjct: 61 ALSNNTMEQLQLFRGDTVLVK 81 >gb|EKG16638.1| ATPase AAA-type VAT [Macrophomina phaseolina MS6] Length = 821 Score = 130 bits (326), Expect = 2e-28 Identities = 66/79 (83%), Positives = 74/79 (93%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MS EPDHAQSK KVKL++DPSGAEK+ +DE ATAIL+KKKKPNSLIVTDAT DDNSII+L Sbjct: 1 MSGEPDHAQSKPKVKLEHDPSGAEKR-EDEVATAILKKKKKPNSLIVTDATNDDNSIISL 59 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+TLQLFRGDTVLV+ Sbjct: 60 SNNTMETLQLFRGDTVLVK 78 >gb|EME47715.1| hypothetical protein DOTSEDRAFT_69609 [Dothistroma septosporum NZE10] Length = 824 Score = 129 bits (324), Expect = 4e-28 Identities = 65/81 (80%), Positives = 74/81 (91%), Gaps = 2/81 (2%) Frame = -2 Query: 237 MSAEPDHAQSK--GKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSII 64 MSAEP H+ +K GKVKLDNDPSGAE++ +D TATAIL+KKKKPNSLIVTDATTDDNSI+ Sbjct: 1 MSAEPSHSNTKPAGKVKLDNDPSGAERRDEDATATAILKKKKKPNSLIVTDATTDDNSIL 60 Query: 63 ALSNNTMDTLQLFRGDTVLVQ 1 ALSNNTM+ LQLFRGDTVLV+ Sbjct: 61 ALSNNTMEQLQLFRGDTVLVK 81 >gb|EMC97874.1| hypothetical protein BAUCODRAFT_31880 [Baudoinia compniacensis UAMH 10762] Length = 826 Score = 129 bits (323), Expect = 5e-28 Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 2/81 (2%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKP--DDETATAILRKKKKPNSLIVTDATTDDNSII 64 MSAEPDH K KVKL++DPSGAE++ ++ETATAILRKKKKPNSLIVTDATTDDNSII Sbjct: 1 MSAEPDHTADKKKVKLEHDPSGAERREPHEEETATAILRKKKKPNSLIVTDATTDDNSII 60 Query: 63 ALSNNTMDTLQLFRGDTVLVQ 1 ALSNNTM+TLQLFRGDTVLV+ Sbjct: 61 ALSNNTMETLQLFRGDTVLVK 81 >ref|XP_007587676.1| putative cell division control protein cdc48 protein [Neofusicoccum parvum UCRNP2] gi|485918134|gb|EOD44864.1| putative cell division control protein cdc48 protein [Neofusicoccum parvum UCRNP2] Length = 821 Score = 127 bits (318), Expect = 2e-27 Identities = 64/79 (81%), Positives = 73/79 (92%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MS EPDHAQ+K KVKL++DPSGAEK+ +DE ATAIL+KKKKPNSLIVTDA DDNSII+L Sbjct: 1 MSGEPDHAQNKPKVKLEHDPSGAEKR-EDEVATAILKKKKKPNSLIVTDAVNDDNSIISL 59 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+TLQLFRGDTVLV+ Sbjct: 60 SNNTMETLQLFRGDTVLVK 78 >gb|EXJ84825.1| cell division control protein 48 [Capronia epimyces CBS 606.96] Length = 820 Score = 126 bits (317), Expect = 3e-27 Identities = 66/79 (83%), Positives = 72/79 (91%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MSAEPDHAQ KGKV L ND SGAEKK + +T+TAIL+KKKKPNSLIVTDAT DDNSIIAL Sbjct: 1 MSAEPDHAQRKGKVNL-NDASGAEKKEELDTSTAILKKKKKPNSLIVTDATNDDNSIIAL 59 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+TLQLFRGDTVLV+ Sbjct: 60 SNNTMETLQLFRGDTVLVK 78 >gb|EXJ94441.1| cell division control protein 48 [Capronia coronata CBS 617.96] Length = 820 Score = 123 bits (308), Expect = 3e-26 Identities = 64/79 (81%), Positives = 70/79 (88%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MSAEPDH KGKV L ND SGAEKK + +T+TAIL+KKKKPNSLIVTDAT DDNSIIAL Sbjct: 1 MSAEPDHTHHKGKVNL-NDASGAEKKEELDTSTAILKKKKKPNSLIVTDATNDDNSIIAL 59 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+TLQLFRGDTVLV+ Sbjct: 60 SNNTMETLQLFRGDTVLVK 78 >gb|EHY59351.1| cell division control protein 48 [Exophiala dermatitidis NIH/UT8656] Length = 821 Score = 122 bits (307), Expect = 4e-26 Identities = 64/79 (81%), Positives = 71/79 (89%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MSAEPDHA KGKV L +D SGAEKK + +T+TAIL+KKKKPNSLIVTDAT DDNSIIAL Sbjct: 1 MSAEPDHAHHKGKVNL-HDASGAEKKDELDTSTAILKKKKKPNSLIVTDATNDDNSIIAL 59 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+TLQLFRGDTVLV+ Sbjct: 60 SNNTMETLQLFRGDTVLVK 78 >ref|XP_001239786.1| hypothetical protein CIMG_09407 [Coccidioides immitis RS] gi|303314629|ref|XP_003067323.1| Cell division control protein 48, putative [Coccidioides posadasii C735 delta SOWgp] gi|240106991|gb|EER25178.1| Cell division control protein 48, putative [Coccidioides posadasii C735 delta SOWgp] gi|320037644|gb|EFW19581.1| cell division control protein Cdc48 [Coccidioides posadasii str. Silveira] gi|392869980|gb|EAS28524.2| cell division control protein 48 [Coccidioides immitis RS] Length = 815 Score = 122 bits (306), Expect = 5e-26 Identities = 63/79 (79%), Positives = 70/79 (88%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MSAEPDH+ K KV L NDPSGAEKK + +TATAIL+KKKKPNSLIVTDA DDNS+IAL Sbjct: 1 MSAEPDHSHHKHKVNL-NDPSGAEKKDELDTATAILKKKKKPNSLIVTDAVNDDNSVIAL 59 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+TLQLFRGDTVLV+ Sbjct: 60 SNNTMETLQLFRGDTVLVK 78 >gb|ETI21065.1| cell division control protein 48 [Cladophialophora carrionii CBS 160.54] Length = 821 Score = 120 bits (301), Expect = 2e-25 Identities = 63/79 (79%), Positives = 70/79 (88%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MSAEPDH Q K KV L +D SGAEKK + +T+TAIL+KKKKPNSLIVTDAT DDNSIIAL Sbjct: 1 MSAEPDHVQEKKKVNL-HDASGAEKKEELDTSTAILKKKKKPNSLIVTDATNDDNSIIAL 59 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+TLQLFRGDTVLV+ Sbjct: 60 SNNTMETLQLFRGDTVLVK 78 >ref|XP_003300847.1| hypothetical protein PTT_12208 [Pyrenophora teres f. teres 0-1] gi|311324808|gb|EFQ91051.1| hypothetical protein PTT_12208 [Pyrenophora teres f. teres 0-1] Length = 819 Score = 120 bits (300), Expect = 3e-25 Identities = 63/79 (79%), Positives = 68/79 (86%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MSAEPDH SK KV L +P GAE K +DETATAIL+KKKKPNSLIVTDA DDNSIIAL Sbjct: 1 MSAEPDH--SKPKVDLSKNPDGAEPKDNDETATAILKKKKKPNSLIVTDAVNDDNSIIAL 58 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+TLQLFRGDTVLV+ Sbjct: 59 SNNTMETLQLFRGDTVLVK 77 >ref|XP_002340232.1| cell division control protein Cdc48 [Talaromyces stipitatus ATCC 10500] gi|218723428|gb|EED22845.1| cell division control protein Cdc48 [Talaromyces stipitatus ATCC 10500] Length = 822 Score = 119 bits (297), Expect = 6e-25 Identities = 61/79 (77%), Positives = 70/79 (88%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MS+EPDH SK +V L +DPSGA+KK + +TATAIL+KKKKPNSLIVTDA DDNSIIAL Sbjct: 1 MSSEPDHVHSKQRVNL-SDPSGADKKEELDTATAILKKKKKPNSLIVTDAVNDDNSIIAL 59 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+TLQLFRGDTVLV+ Sbjct: 60 SNNTMETLQLFRGDTVLVK 78 >gb|EXJ55503.1| cell division control protein 48 [Cladophialophora yegresii CBS 114405] Length = 821 Score = 118 bits (296), Expect = 7e-25 Identities = 62/79 (78%), Positives = 69/79 (87%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MSAEPDH K KV L +D SGAEKK + +T+TAIL+KKKKPNSLIVTDAT DDNSIIAL Sbjct: 1 MSAEPDHVHEKKKVNL-HDASGAEKKEELDTSTAILKKKKKPNSLIVTDATNDDNSIIAL 59 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+TLQLFRGDTVLV+ Sbjct: 60 SNNTMETLQLFRGDTVLVK 78 >gb|EHL00384.1| putative Cell division control protein 48 [Glarea lozoyensis 74030] gi|512198907|gb|EPE27741.1| P-loop containing nucleoside triphosphate hydrolase [Glarea lozoyensis ATCC 20868] Length = 822 Score = 117 bits (293), Expect = 2e-24 Identities = 60/79 (75%), Positives = 68/79 (86%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MSAEPDH + K KV L ND SG+E K D+TATAIL+KKKKPNSL+VTDA DDNS+IAL Sbjct: 1 MSAEPDHVEHKKKVNL-NDASGSEAKAADDTATAILKKKKKPNSLMVTDAVNDDNSVIAL 59 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+TLQLFRGDTVLV+ Sbjct: 60 SNNTMETLQLFRGDTVLVK 78 >ref|XP_001595101.1| hypothetical protein SS1G_03189 [Sclerotinia sclerotiorum 1980] gi|154700977|gb|EDO00716.1| hypothetical protein SS1G_03189 [Sclerotinia sclerotiorum 1980 UF-70] Length = 823 Score = 117 bits (293), Expect = 2e-24 Identities = 60/79 (75%), Positives = 68/79 (86%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MSAEPDH + K KV L ND SGAE K +D+ ATAIL+KKKKPNSL+VTDA DDNS+IAL Sbjct: 1 MSAEPDHVEHKKKVNL-NDASGAEHKGNDDVATAILKKKKKPNSLMVTDAVNDDNSVIAL 59 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+TLQLFRGDTVLV+ Sbjct: 60 SNNTMETLQLFRGDTVLVK 78 >gb|ETN41901.1| cell division control protein 48 [Cyphellophora europaea CBS 101466] Length = 820 Score = 117 bits (292), Expect = 2e-24 Identities = 61/79 (77%), Positives = 67/79 (84%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MSAEPDH K KV L ND SGAEKK + +TATAIL+KKKKPNSL+VTDAT DDNS I L Sbjct: 1 MSAEPDHVPKKDKVNL-NDASGAEKKDELDTATAILKKKKKPNSLMVTDATNDDNSTIVL 59 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+TLQLFRGDTVLV+ Sbjct: 60 SNNTMETLQLFRGDTVLVK 78 >ref|XP_002145141.1| cell division control protein Cdc48 [Talaromyces marneffei ATCC 18224] gi|210074539|gb|EEA28626.1| cell division control protein Cdc48 [Talaromyces marneffei ATCC 18224] Length = 822 Score = 117 bits (292), Expect = 2e-24 Identities = 60/79 (75%), Positives = 68/79 (86%) Frame = -2 Query: 237 MSAEPDHAQSKGKVKLDNDPSGAEKKPDDETATAILRKKKKPNSLIVTDATTDDNSIIAL 58 MS+EPDH K +V L DPSGAEKK + +T+TAIL+KKKKPNSLIVTDA DDNSIIAL Sbjct: 1 MSSEPDHVHHKQRVNL-TDPSGAEKKEEMDTSTAILKKKKKPNSLIVTDAVNDDNSIIAL 59 Query: 57 SNNTMDTLQLFRGDTVLVQ 1 SNNTM+TLQLFRGDTVLV+ Sbjct: 60 SNNTMETLQLFRGDTVLVK 78