BLASTX nr result
ID: Akebia25_contig00046297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00046297 (210 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW68177.1| hypothetical protein ZEAMMB73_133887 [Zea mays] 56 5e-06 >gb|AFW68177.1| hypothetical protein ZEAMMB73_133887 [Zea mays] Length = 282 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 210 EFIKRMCEETRARIKILDGPPGTQERAVLSA 118 EFIK+MCEET+ARIKILDGPPG ERAV++A Sbjct: 251 EFIKKMCEETKARIKILDGPPGVPERAVVTA 281