BLASTX nr result
ID: Akebia25_contig00046114
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00046114 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004299634.1| PREDICTED: uncharacterized protein LOC101314... 57 3e-06 >ref|XP_004299634.1| PREDICTED: uncharacterized protein LOC101314755 [Fragaria vesca subsp. vesca] Length = 351 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/52 (53%), Positives = 35/52 (67%), Gaps = 6/52 (11%) Frame = +2 Query: 29 DQVEREVRDGSCDEGC------VPPSNALLLMRCRSAPLKSWLEEKERSKHN 166 D+++R+ + D+G VPP NALLLMRCRSAP KSWLEEKE + N Sbjct: 217 DRIQRDDKASFGDDGSTSEVPSVPPPNALLLMRCRSAPAKSWLEEKEEEEEN 268