BLASTX nr result
ID: Akebia25_contig00046061
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00046061 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004511721.1| PREDICTED: ethylene-responsive transcription... 58 1e-06 >ref|XP_004511721.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Cicer arietinum] Length = 256 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = -2 Query: 162 MYRKSDCESDIEFLESIRTYLLDDSDHL-LSFPEINSNNTPVDCRTSSFSSLFPC 1 MY +S ESD+ L+SIR +LL DSD L P +NS+N P CR+SSF++L+PC Sbjct: 1 MYGESCYESDLALLDSIRRHLLGDSDVLTFGAPNVNSDNAPFLCRSSSFNNLYPC 55