BLASTX nr result
ID: Akebia25_contig00045797
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00045797 (482 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME85669.1| hypothetical protein MYCFIDRAFT_181747 [Pseudocer... 59 7e-07 >gb|EME85669.1| hypothetical protein MYCFIDRAFT_181747 [Pseudocercospora fijiensis CIRAD86] Length = 523 Score = 58.9 bits (141), Expect = 7e-07 Identities = 41/129 (31%), Positives = 66/129 (51%), Gaps = 19/129 (14%) Frame = +1 Query: 19 SSDPDASNVFNFD--ENDVASDSSDGEHSEIYDFSASRAGTD----RPEENSL------- 159 +SD D + + FD +D A+DS DG SE+Y+F + +D + E+ L Sbjct: 392 ASDDDGNAYYPFDGTTSDSANDS-DGARSEVYEFRFGQGNSDSTLSQDEDEDLLGGHSWV 450 Query: 160 -AEPSPHFDLETGWFSGSMDELSRILKLSSP-DSDIAEPGSP----DEKSTFNERTIDAY 321 +PSP FD TGWF GS+D+LS ++ + SD P SP D + + ++ + Sbjct: 451 GCQPSPQFDPATGWFQGSIDQLSAHVRGGTRIKSDSISPRSPLVRLDSNTANEQNPVNGF 510 Query: 322 LSKYGGTDV 348 L+++ DV Sbjct: 511 LARFQRNDV 519