BLASTX nr result
ID: Akebia25_contig00045538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00045538 (228 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265216.1| PREDICTED: UDP-glycosyltransferase 73C2 [Vit... 56 5e-06 >ref|XP_002265216.1| PREDICTED: UDP-glycosyltransferase 73C2 [Vitis vinifera] Length = 494 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +3 Query: 6 RRKRARELGERARMSMEAEGTSYLNMTLLIKDIMHHVSQKQ 128 RRKRARELGE A+ +ME G+SYLNMTLLI+DIM V+ Q Sbjct: 451 RRKRARELGEMAKRAMEEGGSSYLNMTLLIQDIMQQVTCNQ 491