BLASTX nr result
ID: Akebia25_contig00045238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00045238 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002340402.1| thioredoxin TrxA [Talaromyces stipitatus ATC... 118 1e-24 ref|XP_002340401.1| thioredoxin TrxA [Talaromyces stipitatus ATC... 118 1e-24 ref|XP_002144977.1| thioredoxin TrxA [Talaromyces marneffei ATCC... 115 5e-24 ref|XP_002144976.1| thioredoxin TrxA [Talaromyces marneffei ATCC... 115 5e-24 gb|EME78407.1| hypothetical protein MYCFIDRAFT_205026 [Pseudocer... 105 6e-21 gb|EKG13018.1| Thioredoxin [Macrophomina phaseolina MS6] 105 8e-21 ref|XP_007585614.1| putative thioredoxin protein [Neofusicoccum ... 104 1e-20 gb|EAS28217.2| thioredoxin [Coccidioides immitis RS] 104 1e-20 ref|XP_003067095.1| thioredoxin, putative [Coccidioides posadasi... 104 1e-20 ref|XP_001590794.1| hypothetical protein SS1G_08534 [Sclerotinia... 104 1e-20 ref|XP_001239505.1| hypothetical protein CIMG_09126 [Coccidioide... 104 1e-20 gb|EZF23492.1| thioredoxin [Trichophyton rubrum MR850] gi|607905... 103 2e-20 gb|EQB49288.1| thioredoxin [Colletotrichum gloeosporioides Cg-14] 103 2e-20 ref|XP_007289910.1| Cop c 2-like protein [Marssonina brunnea f. ... 103 2e-20 gb|AAQ87932.1| Cop c 2-like protein [Curvularia lunata] 103 2e-20 gb|EZF74427.1| thioredoxin [Trichophyton soudanense CBS 452.61] ... 102 4e-20 gb|EPS26868.1| hypothetical protein PDE_01808 [Penicillium oxali... 102 5e-20 gb|ENH83492.1| thioredoxin [Colletotrichum orbiculare MAFF 240422] 102 7e-20 gb|EHK98740.1| putative Thioredoxin [Glarea lozoyensis 74030] gi... 102 7e-20 ref|XP_003837113.1| hypothetical protein LEMA_P033470.1 [Leptosp... 101 9e-20 >ref|XP_002340402.1| thioredoxin TrxA [Talaromyces stipitatus ATCC 10500] gi|242762565|ref|XP_002340403.1| thioredoxin TrxA [Talaromyces stipitatus ATCC 10500] gi|218723598|gb|EED23015.1| thioredoxin TrxA [Talaromyces stipitatus ATCC 10500] gi|218723599|gb|EED23016.1| thioredoxin TrxA [Talaromyces stipitatus ATCC 10500] Length = 155 Score = 118 bits (295), Expect = 1e-24 Identities = 54/85 (63%), Positives = 72/85 (84%), Gaps = 1/85 (1%) Frame = -3 Query: 254 VNVQELKSKSEFETAINGSE-LVVVDAFAQWCGPCKVIAPRIEELAGKTEGVKFIKIDVD 78 + V++LK+KSEF+ AI+G++ LVVVDAFA+WCGPCK IAP++ + + V+F+K DVD Sbjct: 51 MGVKQLKNKSEFDQAISGTDKLVVVDAFAEWCGPCKAIAPKVHSWSEEYTDVEFVKFDVD 110 Query: 77 ESPDIAQELGVRAMPSFYFFKNGEK 3 ESPD+AQELGVRAMP+F FFKNG+K Sbjct: 111 ESPDVAQELGVRAMPTFLFFKNGQK 135 >ref|XP_002340401.1| thioredoxin TrxA [Talaromyces stipitatus ATCC 10500] gi|242762570|ref|XP_002340404.1| thioredoxin TrxA [Talaromyces stipitatus ATCC 10500] gi|218723597|gb|EED23014.1| thioredoxin TrxA [Talaromyces stipitatus ATCC 10500] gi|218723600|gb|EED23017.1| thioredoxin TrxA [Talaromyces stipitatus ATCC 10500] Length = 105 Score = 118 bits (295), Expect = 1e-24 Identities = 54/85 (63%), Positives = 72/85 (84%), Gaps = 1/85 (1%) Frame = -3 Query: 254 VNVQELKSKSEFETAINGSE-LVVVDAFAQWCGPCKVIAPRIEELAGKTEGVKFIKIDVD 78 + V++LK+KSEF+ AI+G++ LVVVDAFA+WCGPCK IAP++ + + V+F+K DVD Sbjct: 1 MGVKQLKNKSEFDQAISGTDKLVVVDAFAEWCGPCKAIAPKVHSWSEEYTDVEFVKFDVD 60 Query: 77 ESPDIAQELGVRAMPSFYFFKNGEK 3 ESPD+AQELGVRAMP+F FFKNG+K Sbjct: 61 ESPDVAQELGVRAMPTFLFFKNGQK 85 >ref|XP_002144977.1| thioredoxin TrxA [Talaromyces marneffei ATCC 18224] gi|210074375|gb|EEA28462.1| thioredoxin TrxA [Talaromyces marneffei ATCC 18224] Length = 105 Score = 115 bits (289), Expect = 5e-24 Identities = 52/85 (61%), Positives = 71/85 (83%), Gaps = 1/85 (1%) Frame = -3 Query: 254 VNVQELKSKSEFETAINGSE-LVVVDAFAQWCGPCKVIAPRIEELAGKTEGVKFIKIDVD 78 + V++LK+K+EF+ AI+G++ LVVVDAFA+WCGPCK IAP++ + + V F+K DVD Sbjct: 1 MGVKQLKNKTEFDAAISGTDKLVVVDAFAEWCGPCKAIAPKVHAWSEEHTDVDFVKFDVD 60 Query: 77 ESPDIAQELGVRAMPSFYFFKNGEK 3 ESPD+AQELG+RAMP+F FFKNG+K Sbjct: 61 ESPDVAQELGIRAMPTFLFFKNGQK 85 >ref|XP_002144976.1| thioredoxin TrxA [Talaromyces marneffei ATCC 18224] gi|210074374|gb|EEA28461.1| thioredoxin TrxA [Talaromyces marneffei ATCC 18224] Length = 141 Score = 115 bits (289), Expect = 5e-24 Identities = 52/85 (61%), Positives = 71/85 (83%), Gaps = 1/85 (1%) Frame = -3 Query: 254 VNVQELKSKSEFETAINGSE-LVVVDAFAQWCGPCKVIAPRIEELAGKTEGVKFIKIDVD 78 + V++LK+K+EF+ AI+G++ LVVVDAFA+WCGPCK IAP++ + + V F+K DVD Sbjct: 37 MGVKQLKNKTEFDAAISGTDKLVVVDAFAEWCGPCKAIAPKVHAWSEEHTDVDFVKFDVD 96 Query: 77 ESPDIAQELGVRAMPSFYFFKNGEK 3 ESPD+AQELG+RAMP+F FFKNG+K Sbjct: 97 ESPDVAQELGIRAMPTFLFFKNGQK 121 >gb|EME78407.1| hypothetical protein MYCFIDRAFT_205026 [Pseudocercospora fijiensis CIRAD86] Length = 107 Score = 105 bits (262), Expect = 6e-21 Identities = 49/87 (56%), Positives = 63/87 (72%), Gaps = 1/87 (1%) Frame = -3 Query: 260 MGVNVQELKSKSEFETAINGSE-LVVVDAFAQWCGPCKVIAPRIEELAGKTEGVKFIKID 84 MG V L++K+ F+ A+ + L+V+D FA WCGPCKVIAP++ A E +F KID Sbjct: 1 MGQGVHNLQNKAAFDEALAQKDTLLVLDCFATWCGPCKVIAPKVSAFADSYENARFYKID 60 Query: 83 VDESPDIAQELGVRAMPSFYFFKNGEK 3 VDE PD+AQEL VRAMP+F+ FKNGEK Sbjct: 61 VDECPDVAQELSVRAMPTFFLFKNGEK 87 >gb|EKG13018.1| Thioredoxin [Macrophomina phaseolina MS6] Length = 107 Score = 105 bits (261), Expect = 8e-21 Identities = 47/82 (57%), Positives = 62/82 (75%) Frame = -3 Query: 248 VQELKSKSEFETAINGSELVVVDAFAQWCGPCKVIAPRIEELAGKTEGVKFIKIDVDESP 69 V L+SKS++++A+ ELVV+D FA WCGPCKVIAP++ + + KF K+DVDE P Sbjct: 3 VHNLQSKSDWDSALKEPELVVLDCFATWCGPCKVIAPQVVKFSEAYPNAKFYKLDVDEVP 62 Query: 68 DIAQELGVRAMPSFYFFKNGEK 3 D+AQELG+RAMP+F FK GEK Sbjct: 63 DVAQELGIRAMPTFLLFKGGEK 84 >ref|XP_007585614.1| putative thioredoxin protein [Neofusicoccum parvum UCRNP2] gi|485921102|gb|EOD46908.1| putative thioredoxin protein [Neofusicoccum parvum UCRNP2] Length = 107 Score = 104 bits (260), Expect = 1e-20 Identities = 47/82 (57%), Positives = 61/82 (74%) Frame = -3 Query: 248 VQELKSKSEFETAINGSELVVVDAFAQWCGPCKVIAPRIEELAGKTEGVKFIKIDVDESP 69 V L SKS++++A+ ELVV+D FA WCGPCKVIAP++ + + KF K+DVDE P Sbjct: 4 VHNLSSKSDWDSALKEPELVVLDCFATWCGPCKVIAPQVVKFSEAYPNAKFYKLDVDEVP 63 Query: 68 DIAQELGVRAMPSFYFFKNGEK 3 D+AQELG+RAMP+F FK GEK Sbjct: 64 DVAQELGIRAMPTFLLFKGGEK 85 >gb|EAS28217.2| thioredoxin [Coccidioides immitis RS] Length = 211 Score = 104 bits (259), Expect = 1e-20 Identities = 50/89 (56%), Positives = 63/89 (70%), Gaps = 7/89 (7%) Frame = -3 Query: 248 VQELKSKSEFETAIN-------GSELVVVDAFAQWCGPCKVIAPRIEELAGKTEGVKFIK 90 V LK + F+ AIN G +LVVVD FA WCGPC+ IAP++ E + K V F K Sbjct: 102 VTALKDNAAFQAAINPAAVASEGKKLVVVDCFATWCGPCQAIAPKVNEFSEKYPDVAFYK 161 Query: 89 IDVDESPDIAQELGVRAMPSFYFFKNGEK 3 IDVD++PD+AQELGVRAMP+F FFK+G+K Sbjct: 162 IDVDDAPDVAQELGVRAMPTFVFFKDGQK 190 >ref|XP_003067095.1| thioredoxin, putative [Coccidioides posadasii C735 delta SOWgp] gi|240106763|gb|EER24950.1| thioredoxin, putative [Coccidioides posadasii C735 delta SOWgp] gi|320037345|gb|EFW19282.1| thioredoxin [Coccidioides posadasii str. Silveira] Length = 112 Score = 104 bits (259), Expect = 1e-20 Identities = 50/89 (56%), Positives = 63/89 (70%), Gaps = 7/89 (7%) Frame = -3 Query: 248 VQELKSKSEFETAIN-------GSELVVVDAFAQWCGPCKVIAPRIEELAGKTEGVKFIK 90 V LK + F+ AIN G +LVVVD FA WCGPC+ IAP++ E + K V F K Sbjct: 3 VTALKDNAAFQAAINPAAVASEGKKLVVVDCFATWCGPCQAIAPKVNEFSEKYPDVAFYK 62 Query: 89 IDVDESPDIAQELGVRAMPSFYFFKNGEK 3 IDVD++PD+AQELGVRAMP+F FFK+G+K Sbjct: 63 IDVDDAPDVAQELGVRAMPTFVFFKDGQK 91 >ref|XP_001590794.1| hypothetical protein SS1G_08534 [Sclerotinia sclerotiorum 1980] gi|154692933|gb|EDN92671.1| hypothetical protein SS1G_08534 [Sclerotinia sclerotiorum 1980 UF-70] Length = 146 Score = 104 bits (259), Expect = 1e-20 Identities = 48/89 (53%), Positives = 65/89 (73%) Frame = -3 Query: 269 LAKMGVNVQELKSKSEFETAINGSELVVVDAFAQWCGPCKVIAPRIEELAGKTEGVKFIK 90 +A MGV+ + S S+F+TA+ + +V+VDAFA WCGPCK IAP++ +L+ F+K Sbjct: 38 IANMGVH--NIASASDFKTALTDNSVVIVDAFATWCGPCKAIAPKVAQLSEDYPAAHFVK 95 Query: 89 IDVDESPDIAQELGVRAMPSFYFFKNGEK 3 IDVDE P++AQELGVRAMP+F FK EK Sbjct: 96 IDVDELPEVAQELGVRAMPTFLIFKGSEK 124 >ref|XP_001239505.1| hypothetical protein CIMG_09126 [Coccidioides immitis RS] Length = 100 Score = 104 bits (259), Expect = 1e-20 Identities = 50/89 (56%), Positives = 63/89 (70%), Gaps = 7/89 (7%) Frame = -3 Query: 248 VQELKSKSEFETAIN-------GSELVVVDAFAQWCGPCKVIAPRIEELAGKTEGVKFIK 90 V LK + F+ AIN G +LVVVD FA WCGPC+ IAP++ E + K V F K Sbjct: 3 VTALKDNAAFQAAINPAAVASEGKKLVVVDCFATWCGPCQAIAPKVNEFSEKYPDVAFYK 62 Query: 89 IDVDESPDIAQELGVRAMPSFYFFKNGEK 3 IDVD++PD+AQELGVRAMP+F FFK+G+K Sbjct: 63 IDVDDAPDVAQELGVRAMPTFVFFKDGQK 91 >gb|EZF23492.1| thioredoxin [Trichophyton rubrum MR850] gi|607905099|gb|EZF42448.1| thioredoxin [Trichophyton rubrum CBS 100081] gi|607917387|gb|EZF53291.1| thioredoxin [Trichophyton rubrum CBS 288.86] gi|607929442|gb|EZF63903.1| thioredoxin [Trichophyton rubrum CBS 289.86] gi|607953248|gb|EZF85008.1| thioredoxin [Trichophyton rubrum MR1448] gi|607965525|gb|EZF95846.1| thioredoxin [Trichophyton rubrum MR1459] gi|607989562|gb|EZG17460.1| thioredoxin [Trichophyton rubrum CBS 202.88] gi|607989649|gb|EZG17543.1| thioredoxin [Trichophyton rubrum CBS 202.88] Length = 187 Score = 103 bits (258), Expect = 2e-20 Identities = 47/83 (56%), Positives = 64/83 (77%), Gaps = 1/83 (1%) Frame = -3 Query: 248 VQELKSKSEFETAINGSELVVVDAFAQWCGPCKVIAPRIEELAGK-TEGVKFIKIDVDES 72 VQE+K++ ++ AING +LV++D +A WCGPCK I+P ++ L+ + E V F K+DVDE Sbjct: 85 VQEIKNRDDYMKAINGEKLVLIDCYATWCGPCKAISPVVDRLSEEHCEDVDFYKVDVDEC 144 Query: 71 PDIAQELGVRAMPSFYFFKNGEK 3 DIA ELGVRAMP+F+FFK GEK Sbjct: 145 SDIAAELGVRAMPTFFFFKGGEK 167 >gb|EQB49288.1| thioredoxin [Colletotrichum gloeosporioides Cg-14] Length = 120 Score = 103 bits (258), Expect = 2e-20 Identities = 48/84 (57%), Positives = 62/84 (73%), Gaps = 2/84 (2%) Frame = -3 Query: 248 VQELKSKSEFETAINGSELVVVDAFAQWCGPCKVIAPRIEEL--AGKTEGVKFIKIDVDE 75 V +KSK EF + +LV++DAFA WCGPCK IAP + L A EG++F+KIDVDE Sbjct: 3 VHNVKSKEEFAETLEKHKLVILDAFATWCGPCKAIAPILANLSNAEANEGLRFVKIDVDE 62 Query: 74 SPDIAQELGVRAMPSFYFFKNGEK 3 PD++Q+LG+RAMP+F FKNGEK Sbjct: 63 VPDLSQDLGIRAMPTFLIFKNGEK 86 >ref|XP_007289910.1| Cop c 2-like protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406867030|gb|EKD20069.1| Cop c 2-like protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 170 Score = 103 bits (257), Expect = 2e-20 Identities = 48/88 (54%), Positives = 66/88 (75%) Frame = -3 Query: 266 AKMGVNVQELKSKSEFETAINGSELVVVDAFAQWCGPCKVIAPRIEELAGKTEGVKFIKI 87 A MGV+ LK+K EFE AIN +++V++D FA WCGPCKVIAP++ + + + F K+ Sbjct: 56 ANMGVH--NLKTKDEFEAAINENKIVILDCFATWCGPCKVIAPQVVKFSEEFPKAHFAKL 113 Query: 86 DVDESPDIAQELGVRAMPSFYFFKNGEK 3 DVDE P++A+ELGVRAMP+F FK G+K Sbjct: 114 DVDELPEVARELGVRAMPTFILFKGGKK 141 >gb|AAQ87932.1| Cop c 2-like protein [Curvularia lunata] Length = 112 Score = 103 bits (257), Expect = 2e-20 Identities = 47/83 (56%), Positives = 63/83 (75%), Gaps = 1/83 (1%) Frame = -3 Query: 248 VQELKSKSEFETAINGSE-LVVVDAFAQWCGPCKVIAPRIEELAGKTEGVKFIKIDVDES 72 V L +K++FE AIN E L+V+D FA WCGPCKVIAP++ +L+ K +F K+DVD+ Sbjct: 9 VHNLANKAQFEAAINDKETLMVLDCFATWCGPCKVIAPQVVKLSEKYPNARFFKLDVDDV 68 Query: 71 PDIAQELGVRAMPSFYFFKNGEK 3 PD+AQELG+RAMP+F FK G+K Sbjct: 69 PDVAQELGIRAMPTFLLFKGGDK 91 >gb|EZF74427.1| thioredoxin [Trichophyton soudanense CBS 452.61] gi|607977699|gb|EZG06819.1| thioredoxin [Trichophyton rubrum CBS 735.88] Length = 187 Score = 102 bits (255), Expect = 4e-20 Identities = 47/83 (56%), Positives = 64/83 (77%), Gaps = 1/83 (1%) Frame = -3 Query: 248 VQELKSKSEFETAINGSELVVVDAFAQWCGPCKVIAPRIEELAGKTEG-VKFIKIDVDES 72 VQE+K++ ++ AING +LV++D +A WCGPCK I+P ++ L+ + G V F K+DVDE Sbjct: 85 VQEIKNRDDYMKAINGEKLVLIDCYATWCGPCKAISPVVDRLSEEHCGDVDFYKVDVDEC 144 Query: 71 PDIAQELGVRAMPSFYFFKNGEK 3 DIA ELGVRAMP+F+FFK GEK Sbjct: 145 SDIAAELGVRAMPTFFFFKGGEK 167 >gb|EPS26868.1| hypothetical protein PDE_01808 [Penicillium oxalicum 114-2] Length = 107 Score = 102 bits (254), Expect = 5e-20 Identities = 44/85 (51%), Positives = 65/85 (76%), Gaps = 1/85 (1%) Frame = -3 Query: 254 VNVQELKSKSEF-ETAINGSELVVVDAFAQWCGPCKVIAPRIEELAGKTEGVKFIKIDVD 78 ++++ + SK EF + +N L+V+DA+A WCGPC++IAP+IEE + + V+F K+DV+ Sbjct: 1 MSIEAISSKQEFLDKILNSDGLIVLDAWAPWCGPCRLIAPKIEEFSQEYPNVQFYKVDVE 60 Query: 77 ESPDIAQELGVRAMPSFYFFKNGEK 3 PD+AQE+G RAMP+FYFFK GEK Sbjct: 61 AVPDVAQEIGARAMPTFYFFKKGEK 85 >gb|ENH83492.1| thioredoxin [Colletotrichum orbiculare MAFF 240422] Length = 117 Score = 102 bits (253), Expect = 7e-20 Identities = 48/84 (57%), Positives = 61/84 (72%), Gaps = 2/84 (2%) Frame = -3 Query: 248 VQELKSKSEFETAINGSELVVVDAFAQWCGPCKVIAPRIEELAG--KTEGVKFIKIDVDE 75 V + +K EF A+ E+V+VDAFA WCGPCK IAP + L+ K E + FIKIDVDE Sbjct: 3 VHNVHNKEEFTNALKEHEVVIVDAFATWCGPCKAIAPILANLSNDEKNEDLHFIKIDVDE 62 Query: 74 SPDIAQELGVRAMPSFYFFKNGEK 3 PD++QELG+RAMP+F F+NGEK Sbjct: 63 VPDLSQELGIRAMPTFLIFQNGEK 86 >gb|EHK98740.1| putative Thioredoxin [Glarea lozoyensis 74030] gi|512199513|gb|EPE28346.1| Thioredoxin-like protein [Glarea lozoyensis ATCC 20868] Length = 106 Score = 102 bits (253), Expect = 7e-20 Identities = 45/84 (53%), Positives = 62/84 (73%) Frame = -3 Query: 254 VNVQELKSKSEFETAINGSELVVVDAFAQWCGPCKVIAPRIEELAGKTEGVKFIKIDVDE 75 + V L S F++AI +++VV+D FA WCGPCKVIAP + + + + + F+KIDVDE Sbjct: 1 MGVHNLSSGEAFKSAITENKVVVLDCFATWCGPCKVIAPTVVKFSDEFPSIHFVKIDVDE 60 Query: 74 SPDIAQELGVRAMPSFYFFKNGEK 3 PD+AQELG+RAMP+F FK+GEK Sbjct: 61 VPDVAQELGIRAMPTFLIFKDGEK 84 >ref|XP_003837113.1| hypothetical protein LEMA_P033470.1 [Leptosphaeria maculans JN3] gi|312213671|emb|CBX93673.1| hypothetical protein LEMA_P033470.1 [Leptosphaeria maculans JN3] Length = 210 Score = 101 bits (252), Expect = 9e-20 Identities = 46/83 (55%), Positives = 63/83 (75%), Gaps = 1/83 (1%) Frame = -3 Query: 248 VQELKSKSEFETAINGSE-LVVVDAFAQWCGPCKVIAPRIEELAGKTEGVKFIKIDVDES 72 V L+SK+ F+ A+N + L+V+D FA WCGPCKVIAP++ +L+ K +F K+DVDE Sbjct: 107 VHNLQSKTAFDEALNVKDSLMVLDCFATWCGPCKVIAPQVVKLSDKYPNARFFKLDVDEV 166 Query: 71 PDIAQELGVRAMPSFYFFKNGEK 3 PD+AQELG+RAMP+F FK G+K Sbjct: 167 PDVAQELGIRAMPTFLLFKGGDK 189