BLASTX nr result
ID: Akebia25_contig00045183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00045183 (242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516861.1| hypothetical protein GlmaxMp12 (mitochondrio... 64 2e-08 >ref|YP_007516861.1| hypothetical protein GlmaxMp12 (mitochondrion) [Glycine max] gi|403311590|gb|AFR34338.1| hypothetical protein GlmaxMp12 (mitochondrion) [Glycine max] Length = 100 Score = 64.3 bits (155), Expect = 2e-08 Identities = 35/63 (55%), Positives = 41/63 (65%) Frame = +3 Query: 15 FPASFFLSIGRLRADRCSPGEIGAP*GMPFPVGCSLLCLFHPVPALRQKIFVFDLSSQRN 194 F FL +G ++ D C + +P VGC +LCLFHPV ALR KIFVFDLSSQRN Sbjct: 40 FSYFIFLPVGFVQIDVCRGRLVLLRYALP--VGCYILCLFHPVSALRHKIFVFDLSSQRN 97 Query: 195 KEV 203 KEV Sbjct: 98 KEV 100