BLASTX nr result
ID: Akebia25_contig00044839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00044839 (568 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_398878.1| hypothetical protein NitoCp045 [Nicotiana tomen... 64 2e-08 ref|YP_004891619.1| unnamed protein product (chloroplast) [Nicot... 64 2e-08 gb|EPS74273.1| hypothetical protein M569_00483, partial [Genlise... 64 3e-08 ref|NP_054513.1| hypothetical protein NitaCp037 [Nicotiana tabac... 62 8e-08 gb|EYU38448.1| hypothetical protein MIMGU_mgv1a018999mg, partial... 56 8e-06 >ref|YP_398878.1| hypothetical protein NitoCp045 [Nicotiana tomentosiformis] gi|80750940|dbj|BAE48016.1| hypothetical protein [Nicotiana tomentosiformis] Length = 99 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = +2 Query: 341 HIYKPVHTITTGMNPTRNINYKRKNLLNQSQK*QIQYLSAKEESFQ 478 H+ +H+ITTGMNP RN+N+KRK LLN+ Q+ Q+QYL +KEESFQ Sbjct: 54 HVDDSIHSITTGMNPIRNMNHKRKYLLNRLQEYQLQYLLSKEESFQ 99 >ref|YP_004891619.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|347453920|gb|AEO95578.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454031|gb|AEO95688.1| hypothetical protein [synthetic construct] Length = 99 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = +2 Query: 341 HIYKPVHTITTGMNPTRNINYKRKNLLNQSQK*QIQYLSAKEESFQ 478 H+ +H+ITTGMNP RN+N+KRK LLN+ Q+ Q+QYL +KEESFQ Sbjct: 54 HVDDSIHSITTGMNPIRNMNHKRKYLLNRLQEYQLQYLLSKEESFQ 99 >gb|EPS74273.1| hypothetical protein M569_00483, partial [Genlisea aurea] Length = 81 Score = 63.9 bits (154), Expect = 3e-08 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = -2 Query: 501 NGVNGRYYWKDSSLADRYCICYFCDWFNRXXXXXXXFRVGFIPVVI 364 +G+NGR+YWKDSSL +RYC Y CDW NR FR+ FIPVVI Sbjct: 1 SGINGRHYWKDSSLDNRYCNWYSCDWLNRYFLLWVIFRIRFIPVVI 46 >ref|NP_054513.1| hypothetical protein NitaCp037 [Nicotiana tabacum] gi|78102550|ref|YP_358691.1| hypothetical protein NisyCp046 [Nicotiana sylvestris] gi|11846|emb|CAA77366.1| hypothetical protein [Nicotiana tabacum] gi|77799577|dbj|BAE46666.1| hypothetical protein [Nicotiana sylvestris] gi|225214|prf||1211235AV ORF 99A Length = 99 Score = 62.4 bits (150), Expect = 8e-08 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 320 SVEP*LSHIYKPVHTITTGMNPTRNINYKRKNLLNQSQK*QIQYLSAKEESFQ 478 SVE H+ +H+IT GMNP RN+N+KRK LLN+ Q+ Q+QYL +KEESFQ Sbjct: 47 SVEFLRFHVDDSIHSITRGMNPIRNMNHKRKYLLNRLQEYQLQYLLSKEESFQ 99 >gb|EYU38448.1| hypothetical protein MIMGU_mgv1a018999mg, partial [Mimulus guttatus] Length = 82 Score = 55.8 bits (133), Expect = 8e-06 Identities = 32/61 (52%), Positives = 39/61 (63%), Gaps = 3/61 (4%) Frame = +2 Query: 341 HIYKPVHTITT---GMNPTRNINYKRKNLLNQSQK*QIQYLSAKEESFQ*YRPFTPFPSI 511 H+Y +H IT MN RN+N+KRK L+NQSQ+ Q YL +KEESF RPF P S Sbjct: 23 HVYNSIHPITNYYIRMNLIRNMNHKRKYLVNQSQEYQQLYLLSKEESF---RPFVPLHSN 79 Query: 512 F 514 F Sbjct: 80 F 80