BLASTX nr result
ID: Akebia25_contig00044740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00044740 (441 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001932114.1| conserved hypothetical protein [Pyrenophora ... 60 2e-07 ref|XP_003305578.1| hypothetical protein PTT_18472 [Pyrenophora ... 59 9e-07 gb|EOA85058.1| hypothetical protein SETTUDRAFT_42215 [Setosphaer... 55 8e-06 >ref|XP_001932114.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973720|gb|EDU41219.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 108 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +2 Query: 329 MGAIGTLIPLVILFAVVGGIGWFGYQIYLYSNDLA 433 MGA+ LIPL+ILFAVVGGIGW GYQIYLYSN+LA Sbjct: 1 MGALN-LIPLIILFAVVGGIGWVGYQIYLYSNELA 34 >ref|XP_003305578.1| hypothetical protein PTT_18472 [Pyrenophora teres f. teres 0-1] gi|311317320|gb|EFQ86323.1| hypothetical protein PTT_18472 [Pyrenophora teres f. teres 0-1] Length = 98 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +2 Query: 347 LIPLVILFAVVGGIGWFGYQIYLYSNDLA 433 LIPLVILFAV+GGIGW GYQIYLYSN+LA Sbjct: 7 LIPLVILFAVIGGIGWVGYQIYLYSNELA 35 >gb|EOA85058.1| hypothetical protein SETTUDRAFT_42215 [Setosphaeria turcica Et28A] Length = 93 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +2 Query: 329 MGAIGTLIPLVILFAVVGGIGWFGYQIYLYSNDLA 433 MGA+ LIPLVILFAVVGGIGW YQI+LYSN+LA Sbjct: 1 MGALN-LIPLVILFAVVGGIGWTMYQIFLYSNELA 34