BLASTX nr result
ID: Akebia25_contig00044738
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00044738 (460 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003347229.1| hypothetical protein SMAC_08212 [Sordaria ma... 57 3e-06 ref|XP_002843004.1| predicted protein [Arthroderma otae CBS 1134... 56 6e-06 >ref|XP_003347229.1| hypothetical protein SMAC_08212 [Sordaria macrospora k-hell] gi|380088333|emb|CCC13709.1| unnamed protein product [Sordaria macrospora k-hell] Length = 106 Score = 56.6 bits (135), Expect = 3e-06 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 5/92 (5%) Frame = +2 Query: 95 PKADKVQSVVDGLKELSERVKADEPGTLSY--GVFTNADGTV-LVFARYKDEAAAKAHKE 265 PK DKV+ + + K+ +E VKA+EPGTL Y T D V +V Y D AA +AHK Sbjct: 11 PKEDKVERLKEVGKDTAEWVKANEPGTLQYHWSASTEDDKPVFIVQESYADMAAVEAHKN 70 Query: 266 SPHYAEAIQRA-SSDLEAPP-STNLYQAVGGF 355 SP +AE ++ DL A P + A GGF Sbjct: 71 SPKFAELVELGQKEDLFAKPIKVMMLDAFGGF 102 >ref|XP_002843004.1| predicted protein [Arthroderma otae CBS 113480] gi|238845606|gb|EEQ35268.1| predicted protein [Arthroderma otae CBS 113480] Length = 107 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/90 (35%), Positives = 45/90 (50%), Gaps = 1/90 (1%) Frame = +2 Query: 89 LKPKADKVQSVVDGLKELSERVKADEPGTLS-YGVFTNADGTVLVFARYKDEAAAKAHKE 265 L+PK K V L E +E+VKA+EPG L+ YG+ ++V +Y + A K H Sbjct: 12 LRPKPGKQDEVAKILAETAEKVKANEPGALTYYGLNVRKSNEIIVVEKYANMDAVKVHGG 71 Query: 266 SPHYAEAIQRASSDLEAPPSTNLYQAVGGF 355 S H+ + + LE P L VGGF Sbjct: 72 SEHFKAWSRAVAPLLEGPADVKLASQVGGF 101