BLASTX nr result
ID: Akebia25_contig00044672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00044672 (284 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003661510.1| hypothetical protein MYCTH_2300995 [Myceliop... 56 6e-06 >ref|XP_003661510.1| hypothetical protein MYCTH_2300995 [Myceliophthora thermophila ATCC 42464] gi|347008778|gb|AEO56265.1| hypothetical protein MYCTH_2300995 [Myceliophthora thermophila ATCC 42464] Length = 77 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -2 Query: 121 MSSQEDSFSVNMANSPPPPTDIGSYSRIMLQHTKRQMEA 5 MS+ + ++S +M SPPPP+D+GSYSR M QHTKRQME+ Sbjct: 1 MSTSQRTYSTSMPLSPPPPSDLGSYSRFMHQHTKRQMES 39