BLASTX nr result
ID: Akebia25_contig00044469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00044469 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC91116.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia... 107 2e-21 ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria trit... 105 5e-21 ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [... 105 9e-21 gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botry... 105 9e-21 gb|EPE28149.1| Nucleic acid-binding protein [Glarea lozoyensis A... 104 1e-20 ref|XP_001561242.1| 40S ribosomal protein S28 [Botryotinia fucke... 104 1e-20 gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina M... 103 2e-20 gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F... 103 3e-20 gb|ELR02139.1| 40S ribosomal protein S28 [Pseudogymnoascus destr... 103 3e-20 ref|XP_002153086.1| 40S ribosomal protein S28 [Talaromyces marne... 103 3e-20 ref|XP_003650823.1| 40S ribosomal protein S28 [Thielavia terrest... 103 3e-20 ref|XP_001903978.1| hypothetical protein [Podospora anserina S m... 103 3e-20 gb|EON63938.1| 40S ribosomal protein S28 [Coniosporium apollinis... 102 6e-20 ref|XP_003009124.1| 40S ribosomal protein S28 [Verticillium alfa... 102 6e-20 ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fi... 101 1e-19 ref|XP_003664442.1| hypothetical protein MYCTH_36979, partial [M... 101 1e-19 gb|EFQ35236.1| ribosomal protein S28e [Colletotrichum graminicol... 101 1e-19 emb|CCE33319.1| probable ribosomal protein S28B [Claviceps purpu... 100 2e-19 ref|XP_003000163.1| 40S ribosomal protein S28 [Verticillium alfa... 100 2e-19 ref|XP_960561.1| 40S ribosomal protein S28 [Neurospora crassa OR... 100 2e-19 >gb|EMC91116.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia compniacensis UAMH 10762] Length = 68 Score = 107 bits (266), Expect = 2e-21 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria tritici IPO323] gi|339470532|gb|EGP85629.1| hypothetical protein MYCGRDRAFT_81501 [Zymoseptoria tritici IPO323] gi|452980191|gb|EME79952.1| hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] Length = 68 Score = 105 bits (263), Expect = 5e-21 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 M+SAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|615415585|ref|XP_007584949.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485922014|gb|EOD47615.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485925270|gb|EOD49893.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] Length = 68 Score = 105 bits (261), Expect = 9e-21 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 54 >gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botryotinia fuckeliana BcDW1] Length = 114 Score = 105 bits (261), Expect = 9e-21 Identities = 53/56 (94%), Positives = 55/56 (98%) Frame = -1 Query: 353 AIMESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 A ME++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 45 AKMEASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 100 >gb|EPE28149.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] Length = 68 Score = 104 bits (260), Expect = 1e-20 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 M+S+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_001561242.1| 40S ribosomal protein S28 [Botryotinia fuckeliana B05.10] gi|347829972|emb|CCD45669.1| hypothetical protein BofuT4P34000010001 [Botryotinia fuckeliana T4] Length = 68 Score = 104 bits (260), Expect = 1e-20 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 ME++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MEASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina MS6] gi|407924574|gb|EKG17607.1| Histone core [Macrophomina phaseolina MS6] Length = 68 Score = 103 bits (258), Expect = 2e-20 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 M+SAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 54 >gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F-4157] Length = 68 Score = 103 bits (257), Expect = 3e-20 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 M+++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >gb|ELR02139.1| 40S ribosomal protein S28 [Pseudogymnoascus destructans 20631-21] Length = 68 Score = 103 bits (257), Expect = 3e-20 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 M+++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDTSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_002153086.1| 40S ribosomal protein S28 [Talaromyces marneffei ATCC 18224] gi|242820646|ref|XP_002487548.1| 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] gi|242820650|ref|XP_002487549.1| 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] gi|210064606|gb|EEA18701.1| Ribosomal protein S28e [Talaromyces marneffei ATCC 18224] gi|218714013|gb|EED13437.1| Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] gi|218714014|gb|EED13438.1| Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] Length = 68 Score = 103 bits (257), Expect = 3e-20 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 M+SAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >ref|XP_003650823.1| 40S ribosomal protein S28 [Thielavia terrestris NRRL 8126] gi|346998084|gb|AEO64487.1| hypothetical protein THITE_2110661, partial [Thielavia terrestris NRRL 8126] Length = 67 Score = 103 bits (256), Expect = 3e-20 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 M+S+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_001903978.1| hypothetical protein [Podospora anserina S mat+] gi|170937097|emb|CAP61755.1| unnamed protein product [Podospora anserina S mat+] Length = 68 Score = 103 bits (256), Expect = 3e-20 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 M+S+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >gb|EON63938.1| 40S ribosomal protein S28 [Coniosporium apollinis CBS 100218] Length = 68 Score = 102 bits (254), Expect = 6e-20 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 M+SAKVPVKLVKVTRVLGRTGSRGGV+QVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVSQVRVEFMDDTTRSIIRNVKGPVRENDI 54 >ref|XP_003009124.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|261352270|gb|EEY14698.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|346970282|gb|EGY13734.1| hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] Length = 68 Score = 102 bits (254), Expect = 6e-20 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 M+S+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] gi|588893325|gb|EXF75473.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] Length = 68 Score = 101 bits (251), Expect = 1e-19 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 M+SAK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDETRSIIRNVKGPVREDDI 54 >ref|XP_003664442.1| hypothetical protein MYCTH_36979, partial [Myceliophthora thermophila ATCC 42464] gi|347011712|gb|AEO59197.1| hypothetical protein MYCTH_36979, partial [Myceliophthora thermophila ATCC 42464] Length = 64 Score = 101 bits (251), Expect = 1e-19 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -1 Query: 344 ESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 +S+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 DSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 53 >gb|EFQ35236.1| ribosomal protein S28e [Colletotrichum graminicola M1.001] gi|380474013|emb|CCF46007.1| 40S ribosomal protein S28 [Colletotrichum higginsianum] gi|573067571|gb|ETS87099.1| 40S ribosomal protein S28 [Pestalotiopsis fici W106-1] Length = 68 Score = 101 bits (251), Expect = 1e-19 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 M+SAK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >emb|CCE33319.1| probable ribosomal protein S28B [Claviceps purpurea 20.1] gi|500256292|gb|EON99563.1| putative 40s ribosomal protein s28 protein [Togninia minima UCRPA7] gi|594720915|gb|EXV03803.1| ribosomal protein S28e [Metarhizium robertsii] Length = 68 Score = 100 bits (250), Expect = 2e-19 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 M+S+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >ref|XP_003000163.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|261360820|gb|EEY23248.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|346979706|gb|EGY23158.1| 40S ribosomal protein S28 [Verticillium dahliae VdLs.17] Length = 68 Score = 100 bits (250), Expect = 2e-19 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 M+S+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSSKTPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >ref|XP_960561.1| 40S ribosomal protein S28 [Neurospora crassa OR74A] gi|336276482|ref|XP_003352994.1| 40S ribosomal protein S28 [Sordaria macrospora k-hell] gi|51316762|sp|Q7S6W5.1|RS28_NEUCR RecName: Full=40S ribosomal protein S28 gi|28922054|gb|EAA31325.1| 40S ribosomal protein S28 [Neurospora crassa OR74A] gi|336466085|gb|EGO54250.1| hypothetical protein NEUTE1DRAFT_118111 [Neurospora tetrasperma FGSC 2508] gi|350287069|gb|EGZ68316.1| ribosomal protein S28e [Neurospora tetrasperma FGSC 2509] gi|380092479|emb|CCC09756.1| unnamed protein product [Sordaria macrospora k-hell] Length = 68 Score = 100 bits (250), Expect = 2e-19 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 347 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 186 M+S+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54