BLASTX nr result
ID: Akebia25_contig00044270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00044270 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003296219.1| hypothetical protein PTT_05465 [Pyrenophora ... 88 1e-15 ref|XP_001941668.1| hypothetical protein PTRG_11337 [Pyrenophora... 88 1e-15 gb|EMD64753.1| hypothetical protein COCSADRAFT_88563 [Bipolaris ... 87 3e-15 gb|EOA83830.1| hypothetical protein SETTUDRAFT_164243 [Setosphae... 86 4e-15 gb|EUC44351.1| hypothetical protein COCMIDRAFT_98498 [Bipolaris ... 86 7e-15 gb|EUC36539.1| hypothetical protein COCCADRAFT_87781 [Bipolaris ... 86 7e-15 gb|EMD88222.1| hypothetical protein COCHEDRAFT_1111058 [Bipolari... 86 7e-15 ref|XP_003834257.1| predicted protein [Leptosphaeria maculans JN... 86 7e-15 gb|ESZ99187.1| hypothetical protein SBOR_0394 [Sclerotinia borea... 77 3e-12 gb|EKG15567.1| hypothetical protein MPH_07233 [Macrophomina phas... 76 4e-12 ref|XP_001594787.1| hypothetical protein SS1G_04595 [Sclerotinia... 76 4e-12 gb|EMR88995.1| hypothetical protein BcDW1_2255 [Botryotinia fuck... 75 9e-12 gb|EME44202.1| hypothetical protein DOTSEDRAFT_44481 [Dothistrom... 75 9e-12 gb|EPE31621.1| hypothetical protein GLAREA_12377 [Glarea lozoyen... 74 2e-11 gb|EHL02457.1| hypothetical protein M7I_1537 [Glarea lozoyensis ... 74 2e-11 gb|EMC93488.1| hypothetical protein BAUCODRAFT_37172 [Baudoinia ... 73 4e-11 ref|XP_007590117.1| hypothetical protein CFIO01_02246 [Colletotr... 72 6e-11 gb|EON68230.1| hypothetical protein W97_07488 [Coniosporium apol... 72 6e-11 gb|EMF10830.1| hypothetical protein SEPMUDRAFT_150805 [Sphaeruli... 72 6e-11 gb|EME79725.1| hypothetical protein MYCFIDRAFT_199400 [Pseudocer... 72 6e-11 >ref|XP_003296219.1| hypothetical protein PTT_05465 [Pyrenophora teres f. teres 0-1] gi|311331824|gb|EFQ95686.1| hypothetical protein PTT_05465 [Pyrenophora teres f. teres 0-1] Length = 525 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/57 (68%), Positives = 51/57 (89%) Frame = +1 Query: 160 GKKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYKEPK 330 GKKG+TR+PKRLV+K+ +++L YPF EE+DF++VTRAL KEHIDEVI++SE YKE K Sbjct: 291 GKKGKTRLPKRLVKKQAVIDLGYPFEEEDDFIIVTRALEKEHIDEVIKVSENYKEEK 347 >ref|XP_001941668.1| hypothetical protein PTRG_11337 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977761|gb|EDU44387.1| hypothetical protein PTRG_11337 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 526 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/57 (68%), Positives = 51/57 (89%) Frame = +1 Query: 160 GKKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYKEPK 330 GKKG+TR+PKRLV+K+ +++L YPF EE+DF++VTRAL KEHIDEVI++SE YKE K Sbjct: 292 GKKGKTRLPKRLVKKQAVIDLGYPFEEEDDFIIVTRALEKEHIDEVIKVSENYKEEK 348 >gb|EMD64753.1| hypothetical protein COCSADRAFT_88563 [Bipolaris sorokiniana ND90Pr] Length = 529 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/57 (64%), Positives = 51/57 (89%) Frame = +1 Query: 160 GKKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYKEPK 330 GKKG+TR+PKRLV+K+ +++L YP+ EE+DF++VTRAL KEHIDE+I++SE YKE K Sbjct: 283 GKKGKTRLPKRLVKKQAVIDLGYPYEEEDDFIIVTRALEKEHIDEIIKISESYKEEK 339 >gb|EOA83830.1| hypothetical protein SETTUDRAFT_164243 [Setosphaeria turcica Et28A] Length = 516 Score = 86.3 bits (212), Expect = 4e-15 Identities = 37/57 (64%), Positives = 51/57 (89%) Frame = +1 Query: 160 GKKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYKEPK 330 GKKG+TR+PKRLVRK+ +++L YP+ EE+DF++VTRAL K+HIDE+I++SE YKE K Sbjct: 274 GKKGKTRLPKRLVRKQAVIDLGYPYEEEDDFIIVTRALEKDHIDEIIKVSESYKEEK 330 >gb|EUC44351.1| hypothetical protein COCMIDRAFT_98498 [Bipolaris oryzae ATCC 44560] Length = 526 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/57 (64%), Positives = 50/57 (87%) Frame = +1 Query: 160 GKKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYKEPK 330 GKKG+TR+PKRLV+K+ +++L YP+ EE+DF++VTRAL KEHIDE+I+ SE YKE K Sbjct: 279 GKKGKTRLPKRLVKKQAVIDLGYPYEEEDDFIIVTRALEKEHIDEIIKTSESYKEEK 335 >gb|EUC36539.1| hypothetical protein COCCADRAFT_87781 [Bipolaris zeicola 26-R-13] gi|578484925|gb|EUN22434.1| hypothetical protein COCVIDRAFT_111412 [Bipolaris victoriae FI3] Length = 523 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/57 (64%), Positives = 50/57 (87%) Frame = +1 Query: 160 GKKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYKEPK 330 GKKG+TR+PKRLV+K+ +++L YP+ EE+DF++VTRAL KEHIDE+I+ SE YKE K Sbjct: 276 GKKGKTRLPKRLVKKQAVIDLGYPYEEEDDFIIVTRALEKEHIDEIIKTSESYKEEK 332 >gb|EMD88222.1| hypothetical protein COCHEDRAFT_1111058 [Bipolaris maydis C5] gi|477585110|gb|ENI02199.1| hypothetical protein COCC4DRAFT_145742 [Bipolaris maydis ATCC 48331] Length = 520 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/57 (64%), Positives = 50/57 (87%) Frame = +1 Query: 160 GKKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYKEPK 330 GKKG+TR+PKRLV+K+ +++L YP+ EE+DF++VTRAL KEHIDE+I+ SE YKE K Sbjct: 272 GKKGKTRLPKRLVKKQAVIDLGYPYEEEDDFIIVTRALEKEHIDEIIKTSESYKEEK 328 >ref|XP_003834257.1| predicted protein [Leptosphaeria maculans JN3] gi|312210806|emb|CBX90892.1| predicted protein [Leptosphaeria maculans JN3] Length = 504 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/57 (64%), Positives = 50/57 (87%) Frame = +1 Query: 160 GKKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYKEPK 330 GK+G+TR+PKRLV+K+ ++ L YPF EE++FL+VTRAL KEHIDE+I++SE YKE K Sbjct: 272 GKRGKTRLPKRLVKKQAIIELGYPFEEEDNFLIVTRALEKEHIDEIIKISENYKEEK 328 >gb|ESZ99187.1| hypothetical protein SBOR_0394 [Sclerotinia borealis F-4157] Length = 655 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/53 (62%), Positives = 47/53 (88%) Frame = +1 Query: 163 KKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYK 321 KKG+TRMP RLV K+ +++L+YPFVEE D +++ +ALG+E+IDEVI+LSE+YK Sbjct: 289 KKGKTRMPARLVSKQAIIDLDYPFVEEGDTIIIQKALGRENIDEVIKLSEDYK 341 >gb|EKG15567.1| hypothetical protein MPH_07233 [Macrophomina phaseolina MS6] Length = 538 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/54 (64%), Positives = 43/54 (79%) Frame = +1 Query: 160 GKKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYK 321 GKKG+TRMPKRLV K ++ L YPF EE+DF++V RAL K IDEVI++SE YK Sbjct: 280 GKKGKTRMPKRLVHKSAIIQLGYPFEEEDDFIIVKRALEKPQIDEVIKISETYK 333 >ref|XP_001594787.1| hypothetical protein SS1G_04595 [Sclerotinia sclerotiorum 1980] gi|154702380|gb|EDO02119.1| hypothetical protein SS1G_04595 [Sclerotinia sclerotiorum 1980 UF-70] Length = 607 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/53 (64%), Positives = 46/53 (86%) Frame = +1 Query: 163 KKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYK 321 KKG+TRMP RLV K+ +++L+YPF EE D +++ +ALG+E+IDEVIRLSEEYK Sbjct: 279 KKGKTRMPARLVSKKAIIDLDYPFEEEGDTIIIQKALGRENIDEVIRLSEEYK 331 >gb|EMR88995.1| hypothetical protein BcDW1_2255 [Botryotinia fuckeliana BcDW1] Length = 681 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/53 (62%), Positives = 46/53 (86%) Frame = +1 Query: 163 KKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYK 321 KKG+TRMP RLV K+ +++L+YPF EE D +++ +ALG+E+IDEVI+LSEEYK Sbjct: 285 KKGKTRMPARLVSKKAIIDLDYPFEEEGDTIIIQKALGRENIDEVIKLSEEYK 337 >gb|EME44202.1| hypothetical protein DOTSEDRAFT_44481 [Dothistroma septosporum NZE10] Length = 592 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/60 (60%), Positives = 47/60 (78%) Frame = +1 Query: 145 KERKIGKKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYKE 324 +E + KKG+TRMPKRLVR+E +++L YPF EEEDF ++ AL KE IDEVI +SE YK+ Sbjct: 314 REERRFKKGKTRMPKRLVRREAIMDLGYPFDEEEDFFVLRIALEKEQIDEVIHISETYKD 373 >gb|EPE31621.1| hypothetical protein GLAREA_12377 [Glarea lozoyensis ATCC 20868] Length = 576 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/56 (58%), Positives = 46/56 (82%) Frame = +1 Query: 163 KKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYKEPK 330 KKG+TRMP RLV K+ +++L YPF EE D +++ +ALG+E+IDEVI+LSE+YK K Sbjct: 290 KKGKTRMPARLVSKKAIIDLGYPFEEEGDTIIIMKALGRENIDEVIKLSEDYKSEK 345 >gb|EHL02457.1| hypothetical protein M7I_1537 [Glarea lozoyensis 74030] Length = 572 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/56 (58%), Positives = 46/56 (82%) Frame = +1 Query: 163 KKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYKEPK 330 KKG+TRMP RLV K+ +++L YPF EE D +++ +ALG+E+IDEVI+LSE+YK K Sbjct: 290 KKGKTRMPARLVSKKAIIDLGYPFEEEGDTIIIMKALGRENIDEVIKLSEDYKSEK 345 >gb|EMC93488.1| hypothetical protein BAUCODRAFT_37172 [Baudoinia compniacensis UAMH 10762] Length = 572 Score = 73.2 bits (178), Expect = 4e-11 Identities = 36/59 (61%), Positives = 49/59 (83%) Frame = +1 Query: 148 ERKIGKKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYKE 324 ERKI K+G+TRMPKRLVR+E +++L YPF EEE+F ++ AL K+ IDEVI++SE YK+ Sbjct: 256 ERKI-KRGKTRMPKRLVRREAIMDLGYPFDEEENFFVLRIALEKDQIDEVIKISETYKD 313 >ref|XP_007590117.1| hypothetical protein CFIO01_02246 [Colletotrichum fioriniae PJ7] gi|588906726|gb|EXF86187.1| hypothetical protein CFIO01_02246 [Colletotrichum fioriniae PJ7] Length = 541 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/54 (55%), Positives = 48/54 (88%) Frame = +1 Query: 163 KKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYKE 324 KKG+TR+P+RLV K L++LEYP++EE + ++V +ALG+++IDE+++LSEEYK+ Sbjct: 272 KKGKTRIPQRLVSKRALIDLEYPYIEEGNTIIVLKALGQDNIDELLKLSEEYKQ 325 >gb|EON68230.1| hypothetical protein W97_07488 [Coniosporium apollinis CBS 100218] Length = 524 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/54 (59%), Positives = 44/54 (81%) Frame = +1 Query: 163 KKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYKE 324 K+G+TRMPKRLV K+ ++ YPF EE+DF++V RAL KE IDE+I++SE YK+ Sbjct: 263 KRGKTRMPKRLVDKQAVIQCGYPFEEEDDFIVVRRALQKEQIDEIIKISETYKK 316 >gb|EMF10830.1| hypothetical protein SEPMUDRAFT_150805 [Sphaerulina musiva SO2202] Length = 578 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/59 (59%), Positives = 46/59 (77%) Frame = +1 Query: 148 ERKIGKKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYKE 324 E + KKG+TRMPKRLVR E +++L YPF EEE F ++ AL KE IDEVI++SE+YK+ Sbjct: 322 EERRFKKGKTRMPKRLVRVEAIMDLGYPFEEEESFYVLQIALEKEQIDEVIKISEQYKD 380 >gb|EME79725.1| hypothetical protein MYCFIDRAFT_199400 [Pseudocercospora fijiensis CIRAD86] Length = 435 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/53 (66%), Positives = 43/53 (81%) Frame = +1 Query: 163 KKGQTRMPKRLVRKEVLVNLEYPFVEEEDFLLVTRALGKEHIDEVIRLSEEYK 321 KKG+TRMPKRLVR E +++L YPF EEEDF ++ AL KE IDEVI++SE YK Sbjct: 300 KKGKTRMPKRLVRVEAIMDLGYPFEEEEDFFVLQIALEKEQIDEVIQISETYK 352