BLASTX nr result
ID: Akebia25_contig00044100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00044100 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530166.1| conserved hypothetical protein [Ricinus comm... 70 2e-10 >ref|XP_002530166.1| conserved hypothetical protein [Ricinus communis] gi|223530327|gb|EEF32221.1| conserved hypothetical protein [Ricinus communis] Length = 195 Score = 70.5 bits (171), Expect = 2e-10 Identities = 41/90 (45%), Positives = 53/90 (58%), Gaps = 1/90 (1%) Frame = -1 Query: 269 MAFEVQQKQHTHVVCGGGTRNHSPISXXXXXXGVAAFDSNSNHLHRPIPITLDLF-HSEL 93 MA +VQ +QH H VA S+ L +PI +TL+LF ++ L Sbjct: 1 MALKVQTQQHHHH------------QYHFVGATVATHGSSLTTLCQPISLTLNLFQYANL 48 Query: 92 SSSRVELDEPSPLPLGWQKFLNLKTGDIYY 3 S S +EL+EP PLPLGWQKFLNL+TG+IYY Sbjct: 49 SCSYIELEEPFPLPLGWQKFLNLQTGEIYY 78