BLASTX nr result
ID: Akebia25_contig00044069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00044069 (230 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU77093.1| 60S ribosomal protein L30 [Blumeria graminis f. ... 89 6e-16 gb|EPQ63958.1| Protein component of the large (60S) ribosomal su... 88 1e-15 gb|EHL01065.1| putative 60S ribosomal protein L30 [Glarea lozoye... 87 2e-15 ref|XP_001594073.1| 60S ribosomal protein L30 [Sclerotinia scler... 87 2e-15 gb|EPS37787.1| hypothetical protein H072_8357 [Dactylellina hapt... 87 3e-15 ref|XP_002839830.1| hypothetical protein [Tuber melanosporum Mel... 87 3e-15 ref|XP_006968524.1| ribosomal protein L30 [Trichoderma reesei QM... 84 2e-14 gb|ESZ91510.1| hypothetical protein SBOR_8108 [Sclerotinia borea... 83 5e-14 ref|XP_001551813.1| 60S ribosomal protein L30 [Botryotinia fucke... 83 5e-14 gb|ERF77046.1| 60S ribosomal protein L30-1 [Endocarpon pusillum ... 82 6e-14 gb|EON63881.1| 60S ribosomal protein L30 [Coniosporium apollinis... 82 6e-14 ref|XP_007296807.1| 60S ribosomal protein L10 [Marssonina brunne... 82 6e-14 gb|EWZ37046.1| 60S ribosomal protein L30 [Fusarium oxysporum Fo47] 82 8e-14 gb|EWY90439.1| 60S ribosomal protein L30 [Fusarium oxysporum FOS... 82 8e-14 gb|EWG40661.1| 60S ribosomal protein L30 [Fusarium verticillioid... 82 8e-14 ref|XP_390421.1| hypothetical protein FG10245.1 [Fusarium gramin... 82 8e-14 gb|EHK25520.1| hypothetical protein TRIVIDRAFT_72643 [Trichoderm... 82 8e-14 ref|XP_003050868.1| 60S ribosomal protein L30 [Nectria haematoco... 82 8e-14 gb|EFX03317.1| 60S ribosomal protein [Grosmannia clavigera kw1407] 82 1e-13 gb|EKG17776.1| Ribosomal protein L30e [Macrophomina phaseolina MS6] 81 1e-13 >emb|CCU77093.1| 60S ribosomal protein L30 [Blumeria graminis f. sp. hordei DH14] Length = 110 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 143 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLK+LRSGKAKLVI Sbjct: 1 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVI 47 >gb|EPQ63958.1| Protein component of the large (60S) ribosomal subunit [Blumeria graminis f. sp. tritici 96224] Length = 110 Score = 87.8 bits (216), Expect = 1e-15 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = -1 Query: 143 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAPTKK+KKTADSINSRLALVMKSGKVTLGYKSTLK+LRSGKAKLVI Sbjct: 1 MAPTKKAKKTADSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVI 47 >gb|EHL01065.1| putative 60S ribosomal protein L30 [Glarea lozoyensis 74030] gi|512206497|gb|EPE35316.1| L30e-like protein [Glarea lozoyensis ATCC 20868] Length = 110 Score = 87.0 bits (214), Expect = 2e-15 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -1 Query: 143 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAPTKKSKKTADSINSRLALVMKSGKV LGYKSTLK+LRSGKAKLVI Sbjct: 1 MAPTKKSKKTADSINSRLALVMKSGKVVLGYKSTLKTLRSGKAKLVI 47 >ref|XP_001594073.1| 60S ribosomal protein L30 [Sclerotinia sclerotiorum 1980 UF-70] gi|154703285|gb|EDO03024.1| hypothetical protein SS1G_05501 [Sclerotinia sclerotiorum 1980 UF-70] Length = 128 Score = 87.0 bits (214), Expect = 2e-15 Identities = 48/54 (88%), Positives = 50/54 (92%), Gaps = 1/54 (1%) Frame = -1 Query: 161 NQLSAEMAP-TKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 N +AEMAP TKK+KKTADSINSRLALVMKSGKVTLGYKSTLK LRSGKAKLVI Sbjct: 12 NFKTAEMAPATKKAKKTADSINSRLALVMKSGKVTLGYKSTLKQLRSGKAKLVI 65 >gb|EPS37787.1| hypothetical protein H072_8357 [Dactylellina haptotyla CBS 200.50] Length = 167 Score = 86.7 bits (213), Expect = 3e-15 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = -1 Query: 152 SAEMAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 SAEMAPTKKSKK+ +SINSRLALVMKSGKV LGYKSTLK+LRSGKAKLVI Sbjct: 56 SAEMAPTKKSKKSENSINSRLALVMKSGKVVLGYKSTLKTLRSGKAKLVI 105 >ref|XP_002839830.1| hypothetical protein [Tuber melanosporum Mel28] gi|295636036|emb|CAZ84021.1| unnamed protein product [Tuber melanosporum] Length = 198 Score = 86.7 bits (213), Expect = 3e-15 Identities = 49/76 (64%), Positives = 56/76 (73%), Gaps = 3/76 (3%) Frame = -1 Query: 221 LYPNRHSRLRPERIQFHQPIN---QLSAEMAPTKKSKKTADSINSRLALVMKSGKVTLGY 51 L+ N P++ Q I + SA MAPTKK+KKTADSIN+RLALVMKSGK LGY Sbjct: 61 LHTNFRETYIPQKCQIISSIECFYKQSAAMAPTKKTKKTADSINTRLALVMKSGKYVLGY 120 Query: 50 KSTLKSLRSGKAKLVI 3 KSTLK+LRSGKAKLVI Sbjct: 121 KSTLKTLRSGKAKLVI 136 >ref|XP_006968524.1| ribosomal protein L30 [Trichoderma reesei QM6a] gi|340515348|gb|EGR45603.1| ribosomal protein L30 [Trichoderma reesei QM6a] gi|572275369|gb|ETR98804.1| L30e-like protein [Trichoderma reesei RUT C-30] Length = 110 Score = 84.3 bits (207), Expect = 2e-14 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -1 Query: 143 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAPTKKSKK A+SINS+LALVMKSGKVTLGYKSTLKSLRSGKAKL+I Sbjct: 1 MAPTKKSKKDANSINSKLALVMKSGKVTLGYKSTLKSLRSGKAKLII 47 >gb|ESZ91510.1| hypothetical protein SBOR_8108 [Sclerotinia borealis F-4157] Length = 111 Score = 82.8 bits (203), Expect = 5e-14 Identities = 45/48 (93%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = -1 Query: 143 MAPT-KKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAPT KK+KKTADSINSRLALVMKSGKVTLGYKSTLK LRSGKAKLVI Sbjct: 1 MAPTNKKAKKTADSINSRLALVMKSGKVTLGYKSTLKQLRSGKAKLVI 48 >ref|XP_001551813.1| 60S ribosomal protein L30 [Botryotinia fuckeliana B05.10] gi|347836247|emb|CCD50819.1| similar to 60S ribosomal protein L30 [Botryotinia fuckeliana T4] gi|472238753|gb|EMR83602.1| putative 60s ribosomal protein l30 protein [Botryotinia fuckeliana BcDW1] Length = 111 Score = 82.8 bits (203), Expect = 5e-14 Identities = 45/48 (93%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = -1 Query: 143 MAPT-KKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAPT KK+KKTADSINSRLALVMKSGKVTLGYKSTLK LRSGKAKLVI Sbjct: 1 MAPTTKKAKKTADSINSRLALVMKSGKVTLGYKSTLKQLRSGKAKLVI 48 >gb|ERF77046.1| 60S ribosomal protein L30-1 [Endocarpon pusillum Z07020] Length = 99 Score = 82.4 bits (202), Expect = 6e-14 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -1 Query: 143 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAP KK+KKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI Sbjct: 1 MAP-KKAKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 46 >gb|EON63881.1| 60S ribosomal protein L30 [Coniosporium apollinis CBS 100218] Length = 109 Score = 82.4 bits (202), Expect = 6e-14 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -1 Query: 143 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAP KKSKKTADSINSRLALVMKSGKVTLGYKSTLK+LRSGKAKLVI Sbjct: 1 MAP-KKSKKTADSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVI 46 >ref|XP_007296807.1| 60S ribosomal protein L10 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406859902|gb|EKD12964.1| 60S ribosomal protein L10 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 335 Score = 82.4 bits (202), Expect = 6e-14 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -1 Query: 143 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAP KK+KK AD INSRLALVMKSGKVTLGYKSTLK+LRSGKAKLVI Sbjct: 1 MAPNKKAKKAADGINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVI 47 >gb|EWZ37046.1| 60S ribosomal protein L30 [Fusarium oxysporum Fo47] Length = 98 Score = 82.0 bits (201), Expect = 8e-14 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 143 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAP KKSKK A+SINS+LALVMKSGKVTLGYKSTLKSLRSGKAKL+I Sbjct: 1 MAPQKKSKKDANSINSKLALVMKSGKVTLGYKSTLKSLRSGKAKLII 47 >gb|EWY90439.1| 60S ribosomal protein L30 [Fusarium oxysporum FOSC 3-a] gi|587718957|gb|EWZ90294.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587746902|gb|EXA44618.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. pisi HDV247] gi|590037222|gb|EXK39080.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. melonis 26406] gi|590063044|gb|EXK90568.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. raphani 54005] gi|591421377|gb|EXL56514.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591452730|gb|EXL85024.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591503702|gb|EXM33047.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 98 Score = 82.0 bits (201), Expect = 8e-14 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 143 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAP KKSKK A+SINS+LALVMKSGKVTLGYKSTLKSLRSGKAKL+I Sbjct: 1 MAPQKKSKKDANSINSKLALVMKSGKVTLGYKSTLKSLRSGKAKLII 47 >gb|EWG40661.1| 60S ribosomal protein L30 [Fusarium verticillioides 7600] Length = 98 Score = 82.0 bits (201), Expect = 8e-14 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 143 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAP KKSKK A+SINS+LALVMKSGKVTLGYKSTLKSLRSGKAKL+I Sbjct: 1 MAPQKKSKKDANSINSKLALVMKSGKVTLGYKSTLKSLRSGKAKLII 47 >ref|XP_390421.1| hypothetical protein FG10245.1 [Fusarium graminearum PH-1] Length = 80 Score = 82.0 bits (201), Expect = 8e-14 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 143 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAP KKSKK A+SINS+LALVMKSGKVTLGYKSTLKSLRSGKAKL+I Sbjct: 1 MAPQKKSKKDANSINSKLALVMKSGKVTLGYKSTLKSLRSGKAKLII 47 >gb|EHK25520.1| hypothetical protein TRIVIDRAFT_72643 [Trichoderma virens Gv29-8] gi|358390265|gb|EHK39671.1| hypothetical protein TRIATDRAFT_302987 [Trichoderma atroviride IMI 206040] Length = 110 Score = 82.0 bits (201), Expect = 8e-14 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 143 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAP KKSKK A+SINS+LALVMKSGKVTLGYKSTLKSLRSGKAKL+I Sbjct: 1 MAPQKKSKKDANSINSKLALVMKSGKVTLGYKSTLKSLRSGKAKLII 47 >ref|XP_003050868.1| 60S ribosomal protein L30 [Nectria haematococca mpVI 77-13-4] gi|256731806|gb|EEU45155.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|322710248|gb|EFZ01823.1| 60S ribosomal protein L30 [Metarhizium anisopliae ARSEF 23] gi|342882125|gb|EGU82879.1| hypothetical protein FOXB_06682 [Fusarium oxysporum Fo5176] gi|475665569|gb|EMT63361.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. cubense race 4] gi|477515364|gb|ENH67720.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. cubense race 1] gi|517317192|emb|CCT68423.1| probable ribosomal protein L30, cytosolic [Fusarium fujikuroi IMI 58289] gi|558866850|gb|ESU16933.1| hypothetical protein FGSG_10245 [Fusarium graminearum PH-1] gi|584131266|gb|EWG40660.1| 60S ribosomal protein L30 [Fusarium verticillioides 7600] gi|587668097|gb|EWY90438.1| 60S ribosomal protein L30 [Fusarium oxysporum FOSC 3-a] gi|587690440|gb|EWZ37045.1| 60S ribosomal protein L30 [Fusarium oxysporum Fo47] gi|587718956|gb|EWZ90293.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587746901|gb|EXA44617.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. pisi HDV247] gi|590037221|gb|EXK39079.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. melonis 26406] gi|590063043|gb|EXK90567.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. raphani 54005] gi|591421376|gb|EXL56513.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591452729|gb|EXL85023.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591470649|gb|EXM01953.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591503701|gb|EXM33046.1| 60S ribosomal protein L30 [Fusarium oxysporum f. sp. vasinfectum 25433] gi|594719423|gb|EXV02313.1| 60S ribosomal protein L30 [Metarhizium robertsii] gi|596549065|gb|EYB28760.1| hypothetical protein FG05_10245 [Fusarium graminearum] Length = 110 Score = 82.0 bits (201), Expect = 8e-14 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 143 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAP KKSKK A+SINS+LALVMKSGKVTLGYKSTLKSLRSGKAKL+I Sbjct: 1 MAPQKKSKKDANSINSKLALVMKSGKVTLGYKSTLKSLRSGKAKLII 47 >gb|EFX03317.1| 60S ribosomal protein [Grosmannia clavigera kw1407] Length = 110 Score = 81.6 bits (200), Expect = 1e-13 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -1 Query: 143 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAP KKSKK A+SINSRLALVMKSGKVTLGYKSTLK+LRSGKAKLV+ Sbjct: 1 MAPIKKSKKEANSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLVL 47 >gb|EKG17776.1| Ribosomal protein L30e [Macrophomina phaseolina MS6] Length = 110 Score = 81.3 bits (199), Expect = 1e-13 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -1 Query: 143 MAPTKKSKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVI 3 MAP KK+KKTADSINSRLALVMKSGKVTLGYKSTLK+LRSGKAKLVI Sbjct: 1 MAP-KKNKKTADSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVI 46