BLASTX nr result
ID: Akebia25_contig00044060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00044060 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYE97764.1| dicarboxylate transporter [Aspergillus ruber CBS ... 81 1e-13 gb|EPE30646.1| Mitochondrial carrier [Glarea lozoyensis ATCC 20868] 81 2e-13 gb|EKG21044.1| Mitochondrial substrate/solute carrier [Macrophom... 80 2e-13 gb|EZF30333.1| hypothetical protein H101_06026 [Trichophyton int... 79 5e-13 ref|XP_007589626.1| putative mitochondrial dicarboxylate carrier... 79 5e-13 gb|EGD93672.1| mitochondrial dicarboxylate carrier [Trichophyton... 79 5e-13 gb|ELR05150.1| hypothetical protein GMDG_07192 [Pseudogymnoascus... 79 7e-13 gb|EPE07404.1| mitochondrial dicarboxylate carrier [Ophiostoma p... 79 9e-13 gb|EMR90583.1| putative mitochondrial dicarboxylate protein [Bot... 79 9e-13 emb|CCD44508.1| similar to mitochondrial dicarboxylate carrier [... 79 9e-13 gb|EZF16371.1| hypothetical protein H100_05823 [Trichophyton rub... 78 1e-12 gb|ESZ96028.1| putative mitochondrial dicarboxylate carrier [Scl... 78 1e-12 ref|XP_003236473.1| mitochondrial dicarboxylate carrier [Trichop... 78 1e-12 ref|XP_003174736.1| mitochondrial dicarboxylate carrier [Arthrod... 78 1e-12 gb|EME49243.1| hypothetical protein DOTSEDRAFT_68120 [Dothistrom... 77 2e-12 ref|XP_001554507.1| hypothetical protein BC1G_07095 [Botryotinia... 77 2e-12 ref|XP_003857257.1| hypothetical protein MYCGRDRAFT_83894 [Zymos... 77 3e-12 ref|XP_002846611.1| mitochondrial dicarboxylate transporter [Art... 77 3e-12 emb|CDM35361.1| Mitochondrial dicarboxylate transporter [Penicil... 76 4e-12 gb|EKV12468.1| Mitochondrial dicarboxylate carrier, putative [Pe... 76 4e-12 >gb|EYE97764.1| dicarboxylate transporter [Aspergillus ruber CBS 135680] Length = 312 Score = 81.3 bits (199), Expect = 1e-13 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGIPE 188 W FRGWVPSFIRLGPHTIATFLFLE+HKKIYR+ KG+PE Sbjct: 270 WAFRGWVPSFIRLGPHTIATFLFLEEHKKIYRKLKGVPE 308 >gb|EPE30646.1| Mitochondrial carrier [Glarea lozoyensis ATCC 20868] Length = 315 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGIPE 188 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYR+ KGI + Sbjct: 272 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRRLKGIDD 310 >gb|EKG21044.1| Mitochondrial substrate/solute carrier [Macrophomina phaseolina MS6] Length = 201 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGI 194 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYR+ KGI Sbjct: 163 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRKMKGI 199 >gb|EZF30333.1| hypothetical protein H101_06026 [Trichophyton interdigitale H6] Length = 309 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGIPEDV 182 WMFRGW PSFIRLGPHTIATFLFLEQHKK+YR KG+ +V Sbjct: 267 WMFRGWTPSFIRLGPHTIATFLFLEQHKKVYRALKGVQSEV 307 >ref|XP_007589626.1| putative mitochondrial dicarboxylate carrier protein [Neofusicoccum parvum UCRNP2] gi|485915158|gb|EOD42883.1| putative mitochondrial dicarboxylate carrier protein [Neofusicoccum parvum UCRNP2] Length = 321 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGI 194 WMFRGWVPSFIRLGPHTIATFLFLEQHKK+YR+FK I Sbjct: 283 WMFRGWVPSFIRLGPHTIATFLFLEQHKKLYRKFKDI 319 >gb|EGD93672.1| mitochondrial dicarboxylate carrier [Trichophyton tonsurans CBS 112818] Length = 300 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGIPEDV 182 WMFRGW PSFIRLGPHTIATFLFLEQHKK+YR KG+ +V Sbjct: 258 WMFRGWTPSFIRLGPHTIATFLFLEQHKKVYRALKGVQSEV 298 >gb|ELR05150.1| hypothetical protein GMDG_07192 [Pseudogymnoascus destructans 20631-21] Length = 311 Score = 79.0 bits (193), Expect = 7e-13 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGI 194 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYR+ KG+ Sbjct: 269 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRKAKGL 305 >gb|EPE07404.1| mitochondrial dicarboxylate carrier [Ophiostoma piceae UAMH 11346] Length = 326 Score = 78.6 bits (192), Expect = 9e-13 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGIPE 188 WMF+GWVPSFIRLGPHTI TFLFLE H+K+YRQ KG+PE Sbjct: 286 WMFKGWVPSFIRLGPHTIFTFLFLESHRKLYRQLKGLPE 324 >gb|EMR90583.1| putative mitochondrial dicarboxylate protein [Botryotinia fuckeliana BcDW1] Length = 284 Score = 78.6 bits (192), Expect = 9e-13 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGIPE 188 WMFRGWVPSFIRLGP TIATFLFLEQHKKIYR KGI E Sbjct: 240 WMFRGWVPSFIRLGPQTIATFLFLEQHKKIYRSLKGIAE 278 >emb|CCD44508.1| similar to mitochondrial dicarboxylate carrier [Botryotinia fuckeliana T4] Length = 310 Score = 78.6 bits (192), Expect = 9e-13 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGIPE 188 WMFRGWVPSFIRLGP TIATFLFLEQHKKIYR KGI E Sbjct: 266 WMFRGWVPSFIRLGPQTIATFLFLEQHKKIYRSLKGIAE 304 >gb|EZF16371.1| hypothetical protein H100_05823 [Trichophyton rubrum MR850] gi|607902625|gb|EZF40185.1| hypothetical protein H102_05792 [Trichophyton rubrum CBS 100081] gi|607914945|gb|EZF51015.1| hypothetical protein H103_05819 [Trichophyton rubrum CBS 288.86] gi|607926794|gb|EZF61438.1| hypothetical protein H104_05803 [Trichophyton rubrum CBS 289.86] gi|607938793|gb|EZF72120.1| hypothetical protein H105_05833 [Trichophyton soudanense CBS 452.61] gi|607950755|gb|EZF82736.1| hypothetical protein H110_05811 [Trichophyton rubrum MR1448] gi|607963198|gb|EZF93701.1| hypothetical protein H113_05860 [Trichophyton rubrum MR1459] gi|607975552|gb|EZG04782.1| hypothetical protein H106_05656 [Trichophyton rubrum CBS 735.88] gi|607987251|gb|EZG15315.1| hypothetical protein H107_05954 [Trichophyton rubrum CBS 202.88] Length = 309 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGIPED 185 WMFRGW PSFIRLGPHTIATFLFLEQHKK+YR KG+ + Sbjct: 267 WMFRGWTPSFIRLGPHTIATFLFLEQHKKVYRALKGVQSE 306 >gb|ESZ96028.1| putative mitochondrial dicarboxylate carrier [Sclerotinia borealis F-4157] Length = 316 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGIPE 188 WMFRGWVPSFIRLGPHTIATFLFLE+HK++YR KGI E Sbjct: 272 WMFRGWVPSFIRLGPHTIATFLFLEKHKELYRSLKGIKE 310 >ref|XP_003236473.1| mitochondrial dicarboxylate carrier [Trichophyton rubrum CBS 118892] gi|326461815|gb|EGD87268.1| mitochondrial dicarboxylate carrier [Trichophyton rubrum CBS 118892] Length = 320 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGIPED 185 WMFRGW PSFIRLGPHTIATFLFLEQHKK+YR KG+ + Sbjct: 278 WMFRGWTPSFIRLGPHTIATFLFLEQHKKVYRALKGVQSE 317 >ref|XP_003174736.1| mitochondrial dicarboxylate carrier [Arthroderma gypseum CBS 118893] gi|311340051|gb|EFQ99253.1| mitochondrial dicarboxylate carrier [Arthroderma gypseum CBS 118893] Length = 310 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGIPED 185 WMFRGW PSFIRLGPHTIATFLFLEQHKK+YR KG+ + Sbjct: 268 WMFRGWTPSFIRLGPHTIATFLFLEQHKKVYRALKGVKSE 307 >gb|EME49243.1| hypothetical protein DOTSEDRAFT_68120 [Dothistroma septosporum NZE10] Length = 298 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKG 197 WMF+GWVPSFIRLGPHTIATFLFLEQHKKIYR+ KG Sbjct: 261 WMFKGWVPSFIRLGPHTIATFLFLEQHKKIYRKVKG 296 >ref|XP_001554507.1| hypothetical protein BC1G_07095 [Botryotinia fuckeliana B05.10] Length = 284 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGIPE 188 WMFRGWVPSFIRLGP TIATFLFLEQHKKIYR +GI E Sbjct: 240 WMFRGWVPSFIRLGPQTIATFLFLEQHKKIYRSLQGIAE 278 >ref|XP_003857257.1| hypothetical protein MYCGRDRAFT_83894 [Zymoseptoria tritici IPO323] gi|339477142|gb|EGP92233.1| hypothetical protein MYCGRDRAFT_83894 [Zymoseptoria tritici IPO323] Length = 302 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGI 194 W+F+GWVPSFIRLGPHTIATFLFLEQHKK+YR KGI Sbjct: 264 WVFKGWVPSFIRLGPHTIATFLFLEQHKKLYRSIKGI 300 >ref|XP_002846611.1| mitochondrial dicarboxylate transporter [Arthroderma otae CBS 113480] gi|238841867|gb|EEQ31529.1| mitochondrial dicarboxylate transporter [Arthroderma otae CBS 113480] Length = 312 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKG 197 WMFRGW PSFIRLGPHTIATFLFLEQHKKIYR KG Sbjct: 270 WMFRGWTPSFIRLGPHTIATFLFLEQHKKIYRALKG 305 >emb|CDM35361.1| Mitochondrial dicarboxylate transporter [Penicillium roqueforti] Length = 318 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGI 194 W FRGWVPSFIRLGPHTIATFLFLE+HKK+YR+ KGI Sbjct: 282 WTFRGWVPSFIRLGPHTIATFLFLEEHKKLYRKLKGI 318 >gb|EKV12468.1| Mitochondrial dicarboxylate carrier, putative [Penicillium digitatum PHI26] gi|425778404|gb|EKV16532.1| Mitochondrial dicarboxylate carrier, putative [Penicillium digitatum Pd1] Length = 251 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 304 WMFRGWVPSFIRLGPHTIATFLFLEQHKKIYRQFKGI 194 W FRGWVPSFIRLGPHTIATFLFLE+HKK+YR+ KGI Sbjct: 215 WTFRGWVPSFIRLGPHTIATFLFLEEHKKLYRKLKGI 251