BLASTX nr result
ID: Akebia25_contig00043964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00043964 (269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007545873.1| PREDICTED: polyubiquitin-B isoform X4 [Poeci... 57 4e-06 emb|CAJ41447.1| polyubiquitin [Paralvinella grasslei] 56 6e-06 >ref|XP_007545873.1| PREDICTED: polyubiquitin-B isoform X4 [Poecilia formosa] Length = 379 Score = 56.6 bits (135), Expect = 4e-06 Identities = 31/69 (44%), Positives = 40/69 (57%) Frame = -3 Query: 267 KELEDVRTLVSYNIRNGSTLFLSFSVERKIFVKLPNGKTITFKTKLRDSVEYIKTMIESI 88 K+LED RTL YNI+ STL L +IFVK GKTIT + + D++E +K I+ Sbjct: 124 KQLEDGRTLSDYNIQKESTLHLVLHANMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDK 183 Query: 87 VGFQAVQQR 61 G QQR Sbjct: 184 EGIPPDQQR 192 >emb|CAJ41447.1| polyubiquitin [Paralvinella grasslei] Length = 304 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 2/71 (2%) Frame = -3 Query: 267 KELEDVRTLVSYNIRNGSTLFLSFSVE--RKIFVKLPNGKTITFKTKLRDSVEYIKTMIE 94 K+LED RTL YNI+ STL L + +IFVK GKTIT + + DS+E +KT I+ Sbjct: 200 KQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDSIENVKTKIQ 259 Query: 93 SIVGFQAVQQR 61 G QQR Sbjct: 260 DKEGIPPDQQR 270