BLASTX nr result
ID: Akebia25_contig00043523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00043523 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS79259.1| hypothetical protein PFICI_09112 [Pestalotiopsis ... 74 2e-11 gb|ENH78967.1| hypothetical protein Cob_11692 [Colletotrichum or... 66 4e-09 ref|XP_007279216.1| hypothetical protein CGGC5_8158 [Colletotric... 62 6e-08 emb|CCF46492.1| hypothetical protein CH063_15225, partial [Colle... 62 6e-08 gb|EQB47490.1| hypothetical protein CGLO_13354 [Colletotrichum g... 61 2e-07 dbj|GAD92561.1| hypothetical protein THITE_2118145 [Byssochlamys... 60 4e-07 >gb|ETS79259.1| hypothetical protein PFICI_09112 [Pestalotiopsis fici W106-1] Length = 144 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/63 (52%), Positives = 48/63 (76%) Frame = -3 Query: 248 AMMKATAANPKAAGVPWLRPDMSKPAPPLGPEYGKALVARIKELLAELKTKDGEMTTAKV 69 AM++A + A VPWLRPD++KP+PPLGP YGKA+V RIKEL+ +L+ ++ +M +V Sbjct: 83 AMLQAVKQHEGAKAVPWLRPDLTKPSPPLGPAYGKAMVRRIKELMPQLE-RENKMDMTEV 141 Query: 68 HWY 60 H+Y Sbjct: 142 HYY 144 >gb|ENH78967.1| hypothetical protein Cob_11692 [Colletotrichum orbiculare MAFF 240422] Length = 149 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/56 (53%), Positives = 42/56 (75%) Frame = -3 Query: 251 AAMMKATAANPKAAGVPWLRPDMSKPAPPLGPEYGKALVARIKELLAELKTKDGEM 84 AA+ KA + A VPWLR D SKP+PP+GPEYGK ++AR+KE +A L+ K+G++ Sbjct: 85 AALKKAVSQTQGARSVPWLRHDASKPSPPIGPEYGKMVIARVKETMARLE-KEGKL 139 >ref|XP_007279216.1| hypothetical protein CGGC5_8158 [Colletotrichum gloeosporioides Nara gc5] gi|429856795|gb|ELA31689.1| hypothetical protein CGGC5_8158 [Colletotrichum gloeosporioides Nara gc5] Length = 182 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = -3 Query: 239 KATAANPKAAGVPWLRPDMSKPAPPLGPEYGKALVARIKELLAELKTKDGEM 84 K A A VPWLR D SKP+PP+GPEYGKA+VAR KE LA L+ K+G++ Sbjct: 122 KGVAGAGGAKKVPWLRHDTSKPSPPIGPEYGKAVVARCKETLARLE-KEGKL 172 >emb|CCF46492.1| hypothetical protein CH063_15225, partial [Colletotrichum higginsianum] Length = 76 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/57 (52%), Positives = 39/57 (68%), Gaps = 6/57 (10%) Frame = -3 Query: 248 AMMKATAANPKAAG------VPWLRPDMSKPAPPLGPEYGKALVARIKELLAELKTK 96 A+++ A+ + G VPWLR D KPAPPLGPEYGKA+VAR+KE LA L+ + Sbjct: 7 AVLREAVADAQEGGSAGMKRVPWLRQDPDKPAPPLGPEYGKAMVARVKEALARLEAE 63 >gb|EQB47490.1| hypothetical protein CGLO_13354 [Colletotrichum gloeosporioides Cg-14] Length = 156 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -3 Query: 206 VPWLRPDMSKPAPPLGPEYGKALVARIKELLAELKTKDGEM 84 VPWLR D SKP+PP+GPEYGKA+VAR KE LA L+ K+G++ Sbjct: 107 VPWLRHDTSKPSPPIGPEYGKAVVARCKETLARLE-KEGKL 146 >dbj|GAD92561.1| hypothetical protein THITE_2118145 [Byssochlamys spectabilis No. 5] Length = 143 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -3 Query: 206 VPWLRPDMSKPAPPLGPEYGKALVARIKELLAELKTKDGEMTTAKVHWY 60 VPWLRPD+SKP PPLGP YG+A+V R+KE L L+ G+M + +Y Sbjct: 96 VPWLRPDLSKPTPPLGPRYGEAMVERVKETLKGLQ-DSGKMEEDGIFYY 143