BLASTX nr result
ID: Akebia25_contig00043255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00043255 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002970412.1| hypothetical protein SELMODRAFT_60165 [Selag... 56 6e-06 ref|XP_002978491.1| hypothetical protein SELMODRAFT_108935 [Sela... 56 6e-06 >ref|XP_002970412.1| hypothetical protein SELMODRAFT_60165 [Selaginella moellendorffii] gi|300161928|gb|EFJ28542.1| hypothetical protein SELMODRAFT_60165 [Selaginella moellendorffii] Length = 1070 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/56 (50%), Positives = 41/56 (73%) Frame = -3 Query: 308 QDRFQNNNQTFIAFLNIVMQGQDGIKSILEIYEEVVELFQGNNDDLLEEFKRFLPK 141 ++RFQ+N Q + AFL I+ + + G KSI E+Y+EV LF G++ DLL+EF FLP+ Sbjct: 101 KNRFQDNEQVYKAFLEILNKFRKGSKSITEVYQEVASLF-GHHPDLLDEFTCFLPE 155 >ref|XP_002978491.1| hypothetical protein SELMODRAFT_108935 [Selaginella moellendorffii] gi|300153840|gb|EFJ20477.1| hypothetical protein SELMODRAFT_108935 [Selaginella moellendorffii] Length = 1234 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/56 (50%), Positives = 41/56 (73%) Frame = -3 Query: 308 QDRFQNNNQTFIAFLNIVMQGQDGIKSILEIYEEVVELFQGNNDDLLEEFKRFLPK 141 ++RFQ+N Q + AFL I+ + + G KSI E+Y+EV LF G++ DLL+EF FLP+ Sbjct: 101 KNRFQDNEQVYKAFLEILNKFRKGSKSITEVYQEVASLF-GHHPDLLDEFTCFLPE 155