BLASTX nr result
ID: Akebia25_contig00043008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00043008 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON66442.1| hypothetical protein W97_05540 [Coniosporium apol... 96 7e-18 dbj|GAD97878.1| conserved hypothetical protein [Byssochlamys spe... 95 1e-17 gb|ERF74732.1| hypothetical protein EPUS_04901 [Endocarpon pusil... 94 2e-17 gb|EMC94838.1| hypothetical protein BAUCODRAFT_36106 [Baudoinia ... 92 1e-16 ref|XP_003069285.1| hypothetical protein CPC735_024760 [Coccidio... 92 1e-16 ref|XP_002791923.1| conserved hypothetical protein [Paracoccidio... 92 1e-16 ref|XP_001935679.1| conserved hypothetical protein [Pyrenophora ... 92 1e-16 ref|XP_001241962.1| hypothetical protein CIMG_05858 [Coccidioide... 92 1e-16 gb|ENI10877.1| hypothetical protein COCC4DRAFT_157077 [Bipolaris... 91 1e-16 gb|EMD96019.1| hypothetical protein COCHEDRAFT_1166796 [Bipolari... 91 1e-16 ref|XP_003301229.1| hypothetical protein PTT_12675 [Pyrenophora ... 91 2e-16 gb|EUC50492.1| hypothetical protein COCMIDRAFT_943 [Bipolaris or... 90 3e-16 gb|EMD69245.1| hypothetical protein COCSADRAFT_105516 [Bipolaris... 89 5e-16 gb|EEH16393.1| conserved hypothetical protein [Paracoccidioides ... 89 6e-16 gb|EEQ87147.1| conserved hypothetical protein [Ajellomyces derma... 87 2e-15 ref|XP_002622823.1| conserved hypothetical protein [Ajellomyces ... 87 2e-15 gb|EUN30685.1| hypothetical protein COCVIDRAFT_89706 [Bipolaris ... 87 2e-15 gb|EUC38916.1| hypothetical protein COCCADRAFT_81480 [Bipolaris ... 87 2e-15 gb|EOA90915.1| hypothetical protein SETTUDRAFT_45161 [Setosphaer... 85 1e-14 gb|EHY56385.1| hypothetical protein HMPREF1120_04467 [Exophiala ... 84 2e-14 >gb|EON66442.1| hypothetical protein W97_05540 [Coniosporium apollinis CBS 100218] Length = 432 Score = 95.5 bits (236), Expect = 7e-18 Identities = 46/72 (63%), Positives = 56/72 (77%) Frame = +3 Query: 3 FCLQNKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAV 182 F Q+ ENALK KPK Y+ DH+DIELLRLRNF + KLKD+E+ P+ LE A+LIG V Sbjct: 331 FVSQSSENALKRKPKDYEADHRDIELLRLRNFTIGRKLKDEEVIGPNGLEHLAKLIGTMV 390 Query: 183 PFVTYLNSVVMP 218 PF++YLNSVVMP Sbjct: 391 PFISYLNSVVMP 402 >dbj|GAD97878.1| conserved hypothetical protein [Byssochlamys spectabilis No. 5] Length = 511 Score = 94.7 bits (234), Expect = 1e-17 Identities = 44/72 (61%), Positives = 55/72 (76%) Frame = +3 Query: 3 FCLQNKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAV 182 F QN+ENALK+KPKGYD +H++IELLRLRNF + L D E+ D ++ AEL+G V Sbjct: 419 FASQNRENALKTKPKGYDQEHENIELLRLRNFTMGKPLPDAELLSADAQDKIAELVGIMV 478 Query: 183 PFVTYLNSVVMP 218 PFVTYLNS+VMP Sbjct: 479 PFVTYLNSIVMP 490 >gb|ERF74732.1| hypothetical protein EPUS_04901 [Endocarpon pusillum Z07020] Length = 449 Score = 94.0 bits (232), Expect = 2e-17 Identities = 44/72 (61%), Positives = 56/72 (77%) Frame = +3 Query: 3 FCLQNKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAV 182 F QN+ENALK+KPKGY+ D+ +IELLRL+NF + KL+DDE+ P L+R A L+G Sbjct: 357 FVSQNQENALKTKPKGYEADNPNIELLRLKNFTIGRKLQDDEVVGPGGLDRIASLVGTMT 416 Query: 183 PFVTYLNSVVMP 218 PFVTYLNSV+MP Sbjct: 417 PFVTYLNSVIMP 428 >gb|EMC94838.1| hypothetical protein BAUCODRAFT_36106 [Baudoinia compniacensis UAMH 10762] Length = 393 Score = 91.7 bits (226), Expect = 1e-16 Identities = 45/72 (62%), Positives = 53/72 (73%) Frame = +3 Query: 3 FCLQNKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAV 182 F N ENALK+KPKG+D DHKDIELLRLRN+ + KLKD E+ +ER AEL+ Sbjct: 296 FVAGNSENALKTKPKGFDADHKDIELLRLRNYTVGTKLKDGEVLGSQGMERIAELLACMK 355 Query: 183 PFVTYLNSVVMP 218 PF+TYLNSVVMP Sbjct: 356 PFITYLNSVVMP 367 >ref|XP_003069285.1| hypothetical protein CPC735_024760 [Coccidioides posadasii C735 delta SOWgp] gi|240108971|gb|EER27140.1| hypothetical protein CPC735_024760 [Coccidioides posadasii C735 delta SOWgp] Length = 428 Score = 91.7 bits (226), Expect = 1e-16 Identities = 43/72 (59%), Positives = 57/72 (79%) Frame = +3 Query: 3 FCLQNKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAV 182 F QN+E ALK+KPKGY ++K+IELLRLR+F L +L+D+++ P+ L+R A +IG V Sbjct: 336 FISQNQETALKTKPKGYSSENKNIELLRLRSFTLNKQLRDEDLLGPEALDRIASIIGIMV 395 Query: 183 PFVTYLNSVVMP 218 PFVTYLNSVVMP Sbjct: 396 PFVTYLNSVVMP 407 >ref|XP_002791923.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] gi|226279575|gb|EEH35141.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] Length = 454 Score = 91.7 bits (226), Expect = 1e-16 Identities = 43/72 (59%), Positives = 55/72 (76%) Frame = +3 Query: 3 FCLQNKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAV 182 F QN+ENALK+KPKGYD D+K+I+LLRLR F + KL+D ++ P L+R A ++G Sbjct: 338 FVGQNQENALKTKPKGYDADNKNIDLLRLRGFTINKKLQDKDLLGPKALDRVARIVGIMA 397 Query: 183 PFVTYLNSVVMP 218 PFVTYLNSVVMP Sbjct: 398 PFVTYLNSVVMP 409 >ref|XP_001935679.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187982778|gb|EDU48266.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 403 Score = 91.7 bits (226), Expect = 1e-16 Identities = 44/68 (64%), Positives = 51/68 (75%) Frame = +3 Query: 15 NKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAVPFVT 194 NK NALK PKGYDHDHKDI+LLRLRNF + KL+DD++ L R AEL+ PF+T Sbjct: 307 NKSNALKRNPKGYDHDHKDIDLLRLRNFTVGRKLEDDKVVGTGGLSRIAELVLCLEPFIT 366 Query: 195 YLNSVVMP 218 YLNSVVMP Sbjct: 367 YLNSVVMP 374 >ref|XP_001241962.1| hypothetical protein CIMG_05858 [Coccidioides immitis RS] gi|392864866|gb|EAS30588.2| TIGR02453 family protein [Coccidioides immitis RS] Length = 429 Score = 91.7 bits (226), Expect = 1e-16 Identities = 43/72 (59%), Positives = 57/72 (79%) Frame = +3 Query: 3 FCLQNKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAV 182 F QN+E ALK+KPKGY ++K+IELLRLR+F L +L+D+++ P+ L+R A +IG V Sbjct: 337 FISQNQETALKTKPKGYSSENKNIELLRLRSFTLNKQLRDEDLLGPEALDRIASIIGIMV 396 Query: 183 PFVTYLNSVVMP 218 PFVTYLNSVVMP Sbjct: 397 PFVTYLNSVVMP 408 >gb|ENI10877.1| hypothetical protein COCC4DRAFT_157077 [Bipolaris maydis ATCC 48331] Length = 425 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/68 (63%), Positives = 51/68 (75%) Frame = +3 Query: 15 NKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAVPFVT 194 N+ NALK PKGYDHDHKDI+LLRLRNF + + D+EI LER AE++ VPF+T Sbjct: 324 NQSNALKRNPKGYDHDHKDIDLLRLRNFTIGRTIADEEIVGTGGLERVAEVVRAMVPFIT 383 Query: 195 YLNSVVMP 218 YLNSVVMP Sbjct: 384 YLNSVVMP 391 >gb|EMD96019.1| hypothetical protein COCHEDRAFT_1166796 [Bipolaris maydis C5] Length = 409 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/68 (63%), Positives = 51/68 (75%) Frame = +3 Query: 15 NKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAVPFVT 194 N+ NALK PKGYDHDHKDI+LLRLRNF + + D+EI LER AE++ VPF+T Sbjct: 308 NQSNALKRNPKGYDHDHKDIDLLRLRNFTIGRTIADEEIVGTGGLERVAEVVRAMVPFIT 367 Query: 195 YLNSVVMP 218 YLNSVVMP Sbjct: 368 YLNSVVMP 375 >ref|XP_003301229.1| hypothetical protein PTT_12675 [Pyrenophora teres f. teres 0-1] gi|311324246|gb|EFQ90675.1| hypothetical protein PTT_12675 [Pyrenophora teres f. teres 0-1] Length = 420 Score = 90.9 bits (224), Expect = 2e-16 Identities = 44/68 (64%), Positives = 52/68 (76%) Frame = +3 Query: 15 NKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAVPFVT 194 NK NALK PKGYDHDHKDIELLRLRNF++ +L+DD++ L R AEL+ PF+T Sbjct: 325 NKSNALKRNPKGYDHDHKDIELLRLRNFIMGLELEDDKVVGTGGLGRIAELVLCLEPFIT 384 Query: 195 YLNSVVMP 218 YLNSVVMP Sbjct: 385 YLNSVVMP 392 >gb|EUC50492.1| hypothetical protein COCMIDRAFT_943 [Bipolaris oryzae ATCC 44560] Length = 418 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/68 (63%), Positives = 51/68 (75%) Frame = +3 Query: 15 NKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAVPFVT 194 N+ NALK PKGYDHDHKDI+LLRLRNF + ++ D+ I LER AEL+ VPF+T Sbjct: 326 NQSNALKRNPKGYDHDHKDIDLLRLRNFTIGRRVADEVIVGTGGLERVAELVMAMVPFIT 385 Query: 195 YLNSVVMP 218 YLNSVVMP Sbjct: 386 YLNSVVMP 393 >gb|EMD69245.1| hypothetical protein COCSADRAFT_105516 [Bipolaris sorokiniana ND90Pr] Length = 418 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/68 (63%), Positives = 50/68 (73%) Frame = +3 Query: 15 NKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAVPFVT 194 N+ NALK PKGYDHDHKDI+LLRLRNF + + D+ I LER AEL+ VPF+T Sbjct: 325 NQSNALKRNPKGYDHDHKDIDLLRLRNFTIGRTVADEVIVGTSGLERVAELVMAMVPFIT 384 Query: 195 YLNSVVMP 218 YLNSVVMP Sbjct: 385 YLNSVVMP 392 >gb|EEH16393.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03] Length = 493 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/72 (55%), Positives = 55/72 (76%) Frame = +3 Query: 3 FCLQNKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAV 182 F QN+ENALK+KPKGYD D+K+I+L+RLR F + +L+D ++ P L++ A ++G Sbjct: 383 FVGQNQENALKTKPKGYDADNKNIDLIRLRGFTMSKRLQDKDLLGPKALDKVAHIVGIMA 442 Query: 183 PFVTYLNSVVMP 218 PFVTYLNSVVMP Sbjct: 443 PFVTYLNSVVMP 454 >gb|EEQ87147.1| conserved hypothetical protein [Ajellomyces dermatitidis ER-3] gi|327358025|gb|EGE86882.1| hypothetical protein BDDG_09833 [Ajellomyces dermatitidis ATCC 18188] gi|531984628|gb|EQL35215.1| hypothetical protein BDFG_02975 [Ajellomyces dermatitidis ATCC 26199] Length = 460 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/72 (56%), Positives = 55/72 (76%) Frame = +3 Query: 3 FCLQNKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAV 182 F QN+E+ALK+KPKGYD D+K+I+LLRLR+F + +L+D ++ P L+R A + V Sbjct: 355 FVSQNQESALKTKPKGYDADNKNIDLLRLRSFTISKRLEDKDLLGPKALDRVARTVEIMV 414 Query: 183 PFVTYLNSVVMP 218 PFVTYLNSVVMP Sbjct: 415 PFVTYLNSVVMP 426 >ref|XP_002622823.1| conserved hypothetical protein [Ajellomyces dermatitidis SLH14081] gi|239589305|gb|EEQ71948.1| conserved hypothetical protein [Ajellomyces dermatitidis SLH14081] Length = 460 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/72 (56%), Positives = 55/72 (76%) Frame = +3 Query: 3 FCLQNKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAV 182 F QN+E+ALK+KPKGYD D+K+I+LLRLR+F + +L+D ++ P L+R A + V Sbjct: 355 FVSQNQESALKTKPKGYDADNKNIDLLRLRSFTISKRLEDKDLLGPKALDRVARTVEIMV 414 Query: 183 PFVTYLNSVVMP 218 PFVTYLNSVVMP Sbjct: 415 PFVTYLNSVVMP 426 >gb|EUN30685.1| hypothetical protein COCVIDRAFT_89706 [Bipolaris victoriae FI3] Length = 418 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/68 (61%), Positives = 50/68 (73%) Frame = +3 Query: 15 NKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAVPFVT 194 N+ NALK PKGYDHDHKDI+LLRLRNF + + D+ I LER AE++ VPF+T Sbjct: 325 NQSNALKRNPKGYDHDHKDIDLLRLRNFTIGCTVADEVIVGTGGLERVAEVVRAMVPFIT 384 Query: 195 YLNSVVMP 218 YLNSVVMP Sbjct: 385 YLNSVVMP 392 >gb|EUC38916.1| hypothetical protein COCCADRAFT_81480 [Bipolaris zeicola 26-R-13] Length = 418 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/68 (61%), Positives = 50/68 (73%) Frame = +3 Query: 15 NKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAVPFVT 194 N+ NALK PKGYDHDHKDI+LLRLRNF + + D+ I LER AE++ VPF+T Sbjct: 325 NQSNALKRNPKGYDHDHKDIDLLRLRNFTIGCTVADEVIVGTGGLERVAEVVRAMVPFIT 384 Query: 195 YLNSVVMP 218 YLNSVVMP Sbjct: 385 YLNSVVMP 392 >gb|EOA90915.1| hypothetical protein SETTUDRAFT_45161 [Setosphaeria turcica Et28A] Length = 437 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/68 (60%), Positives = 49/68 (72%) Frame = +3 Query: 15 NKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAVPFVT 194 NK ALK PKGYDH+H+DIELLRLR+ L K++DDEI P L R AEL+ PF++ Sbjct: 324 NKSTALKRNPKGYDHNHRDIELLRLRSLTLGRKVEDDEIVGPGGLGRVAELVLAMSPFIS 383 Query: 195 YLNSVVMP 218 YLN VVMP Sbjct: 384 YLNGVVMP 391 >gb|EHY56385.1| hypothetical protein HMPREF1120_04467 [Exophiala dermatitidis NIH/UT8656] Length = 465 Score = 84.3 bits (207), Expect = 2e-14 Identities = 41/72 (56%), Positives = 52/72 (72%) Frame = +3 Query: 3 FCLQNKENALKSKPKGYDHDHKDIELLRLRNFVLVHKLKDDEIARPDILERAAELIGFAV 182 F QN +NALK+KPKGY+ ++ +IELLRLRNF L + D+ + L++ ELIG V Sbjct: 379 FAAQNSDNALKTKPKGYEANNPNIELLRLRNFTLGKPIPDEVVVSEQGLQKIVELIGVMV 438 Query: 183 PFVTYLNSVVMP 218 PFVTYLNSVVMP Sbjct: 439 PFVTYLNSVVMP 450