BLASTX nr result
ID: Akebia25_contig00042943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00042943 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMR72735.1| hypothetical protein UCREL1_205 [Eutypa lata UCREL1] 72 6e-11 ref|XP_001228878.1| predicted protein [Chaetomium globosum CBS 1... 57 3e-06 >gb|EMR72735.1| hypothetical protein UCREL1_205 [Eutypa lata UCREL1] Length = 507 Score = 72.4 bits (176), Expect = 6e-11 Identities = 41/100 (41%), Positives = 55/100 (55%), Gaps = 8/100 (8%) Frame = -2 Query: 315 IACTNIGSTTKSVDCCYPDSLSSAVCQQIFDT----NNGTLKKGCTGQV---DPAGCLSQ 157 +AC NIG+ T +CC + SS CQ F +G L KGC D GC++ Sbjct: 8 LACLNIGNDT--FECCTSEDPSSRACQAAFPAFSNGEDGILDKGCRDDFLTEDAPGCIAG 65 Query: 156 CHRRSILYGSLQQDV-LQGNGVGPIRRYSACVNVPSIFNA 40 C R +LYGS QD + +G GPI R+++CVNVP+I A Sbjct: 66 CQRLGLLYGSYLQDGDINASGRGPIERFASCVNVPAIAKA 105 >ref|XP_001228878.1| predicted protein [Chaetomium globosum CBS 148.51] gi|88182959|gb|EAQ90427.1| predicted protein [Chaetomium globosum CBS 148.51] Length = 535 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/104 (29%), Positives = 45/104 (43%), Gaps = 6/104 (5%) Frame = -2 Query: 315 IACTNIGS------TTKSVDCCYPDSLSSAVCQQIFDTNNGTLKKGCTGQVDPAGCLSQC 154 IAC +G T CCY + +S C++IF G C G + +C Sbjct: 10 IACDGLGKYISLSDTVARDQCCYLNEQNSTACRRIFAPTTGLFDSACLGSPETCRLYDRC 69 Query: 153 HRRSILYGSLQQDVLQGNGVGPIRRYSACVNVPSIFNALNNNVL 22 LY S +Q+ GNG + RY AC N+P I + + +L Sbjct: 70 RSAESLYTSAEQNNQVGNGSLLLARYKACANLPIIASFSSQGLL 113