BLASTX nr result
ID: Akebia25_contig00042534
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00042534 (209 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317465.1| tetratricopeptide repeat-containing family p... 133 3e-29 ref|XP_007133199.1| hypothetical protein PHAVU_011G160000g [Phas... 132 5e-29 ref|XP_002524280.1| Small glutamine-rich tetratricopeptide repea... 131 1e-28 ref|XP_006370168.1| hypothetical protein POPTR_0001s40310g [Popu... 129 4e-28 ref|XP_007149399.1| hypothetical protein PHAVU_005G067000g [Phas... 129 5e-28 ref|XP_006493603.1| PREDICTED: TPR repeat-containing thioredoxin... 128 7e-28 ref|XP_006442537.1| hypothetical protein CICLE_v10019057mg [Citr... 128 7e-28 ref|XP_003525985.1| PREDICTED: TPR repeat-containing thioredoxin... 128 9e-28 ref|XP_007021716.1| Tetratricopetide-repeat thioredoxin-like 1 i... 127 1e-27 ref|XP_007021715.1| Tetratricopetide-repeat thioredoxin-like 1 i... 127 1e-27 ref|XP_007021714.1| Tetratricopetide-repeat thioredoxin-like 1 i... 127 1e-27 ref|XP_007021713.1| Tetratricopetide-repeat thioredoxin-like 1 i... 127 1e-27 ref|XP_003541820.1| PREDICTED: TPR repeat-containing thioredoxin... 127 1e-27 gb|ACU18444.1| unknown [Glycine max] 127 1e-27 ref|XP_006592931.1| PREDICTED: TPR repeat-containing thioredoxin... 127 2e-27 ref|XP_003556806.1| PREDICTED: TPR repeat-containing thioredoxin... 126 3e-27 ref|XP_004294076.1| PREDICTED: TPR repeat-containing thioredoxin... 125 5e-27 gb|EPS72637.1| hypothetical protein M569_02119, partial [Genlise... 125 8e-27 emb|CBI21978.3| unnamed protein product [Vitis vinifera] 125 8e-27 ref|XP_002276519.1| PREDICTED: TPR repeat-containing thioredoxin... 125 8e-27 >ref|XP_002317465.1| tetratricopeptide repeat-containing family protein [Populus trichocarpa] gi|222860530|gb|EEE98077.1| tetratricopeptide repeat-containing family protein [Populus trichocarpa] Length = 698 Score = 133 bits (334), Expect = 3e-29 Identities = 59/69 (85%), Positives = 66/69 (95%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPSNSVLYCNRAACW KLG WERS++DCN+AL+IQPNYTKALLRRAASN KLERWA+++R Sbjct: 488 DPSNSVLYCNRAACWFKLGSWERSIDDCNQALRIQPNYTKALLRRAASNSKLERWADAVR 547 Query: 181 DYEVLRREL 207 DYEVLRREL Sbjct: 548 DYEVLRREL 556 >ref|XP_007133199.1| hypothetical protein PHAVU_011G160000g [Phaseolus vulgaris] gi|561006199|gb|ESW05193.1| hypothetical protein PHAVU_011G160000g [Phaseolus vulgaris] Length = 679 Score = 132 bits (332), Expect = 5e-29 Identities = 58/69 (84%), Positives = 66/69 (95%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPSNSVLYCNRAACW KLGQWERS+EDCN+AL+IQPNYTKA+LRRAASN KLERW E+++ Sbjct: 475 DPSNSVLYCNRAACWFKLGQWERSIEDCNQALRIQPNYTKAILRRAASNSKLERWEEAVK 534 Query: 181 DYEVLRREL 207 DYE+LRREL Sbjct: 535 DYELLRREL 543 >ref|XP_002524280.1| Small glutamine-rich tetratricopeptide repeat-containing protein A, putative [Ricinus communis] gi|223536471|gb|EEF38119.1| Small glutamine-rich tetratricopeptide repeat-containing protein A, putative [Ricinus communis] Length = 640 Score = 131 bits (329), Expect = 1e-28 Identities = 58/69 (84%), Positives = 66/69 (95%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPSNSVLYCNRAACW KLG WERS++DCN+AL+IQPNYTKALLRRAASN KLERWA+++R Sbjct: 436 DPSNSVLYCNRAACWFKLGVWERSIDDCNQALRIQPNYTKALLRRAASNSKLERWADAVR 495 Query: 181 DYEVLRREL 207 DYEVLR+EL Sbjct: 496 DYEVLRKEL 504 >ref|XP_006370168.1| hypothetical protein POPTR_0001s40310g [Populus trichocarpa] gi|550349347|gb|ERP66737.1| hypothetical protein POPTR_0001s40310g [Populus trichocarpa] Length = 688 Score = 129 bits (324), Expect = 4e-28 Identities = 58/69 (84%), Positives = 64/69 (92%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPSNSVLYCNRAACW K G WERS++DCN+AL IQPNYTKALLRRAASN KLERWA+++R Sbjct: 484 DPSNSVLYCNRAACWFKRGLWERSIDDCNQALSIQPNYTKALLRRAASNSKLERWADAVR 543 Query: 181 DYEVLRREL 207 DYEVLRREL Sbjct: 544 DYEVLRREL 552 >ref|XP_007149399.1| hypothetical protein PHAVU_005G067000g [Phaseolus vulgaris] gi|561022663|gb|ESW21393.1| hypothetical protein PHAVU_005G067000g [Phaseolus vulgaris] Length = 688 Score = 129 bits (323), Expect = 5e-28 Identities = 58/69 (84%), Positives = 64/69 (92%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPSNSVLYCNRAACW KLGQWERS+ED N+AL IQPNYTKALLRRAASN KLERW E+++ Sbjct: 484 DPSNSVLYCNRAACWFKLGQWERSIEDSNQALHIQPNYTKALLRRAASNSKLERWEEAVK 543 Query: 181 DYEVLRREL 207 DYE+LRREL Sbjct: 544 DYEILRREL 552 >ref|XP_006493603.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Citrus sinensis] Length = 712 Score = 128 bits (322), Expect = 7e-28 Identities = 59/69 (85%), Positives = 65/69 (94%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPSNSVLYCNRAACW KLGQWERSVED N+AL IQPNYTKALLRRAASN KLE+WA+++R Sbjct: 508 DPSNSVLYCNRAACWFKLGQWERSVEDSNQALLIQPNYTKALLRRAASNSKLEKWADAVR 567 Query: 181 DYEVLRREL 207 D+EVLRREL Sbjct: 568 DFEVLRREL 576 >ref|XP_006442537.1| hypothetical protein CICLE_v10019057mg [Citrus clementina] gi|557544799|gb|ESR55777.1| hypothetical protein CICLE_v10019057mg [Citrus clementina] Length = 714 Score = 128 bits (322), Expect = 7e-28 Identities = 59/69 (85%), Positives = 65/69 (94%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPSNSVLYCNRAACW KLGQWERSVED N+AL IQPNYTKALLRRAASN KLE+WA+++R Sbjct: 510 DPSNSVLYCNRAACWFKLGQWERSVEDSNQALLIQPNYTKALLRRAASNSKLEKWADAVR 569 Query: 181 DYEVLRREL 207 D+EVLRREL Sbjct: 570 DFEVLRREL 578 >ref|XP_003525985.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 678 Score = 128 bits (321), Expect = 9e-28 Identities = 57/69 (82%), Positives = 64/69 (92%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPSNSVLYCNRAACW KLGQWERS+EDCN+AL IQP+YTKA+LRRAASN KLERW E++ Sbjct: 474 DPSNSVLYCNRAACWFKLGQWERSIEDCNQALHIQPDYTKAILRRAASNSKLERWEEAVT 533 Query: 181 DYEVLRREL 207 DYE+LRREL Sbjct: 534 DYELLRREL 542 >ref|XP_007021716.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 4, partial [Theobroma cacao] gi|508721344|gb|EOY13241.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 4, partial [Theobroma cacao] Length = 628 Score = 127 bits (320), Expect = 1e-27 Identities = 59/69 (85%), Positives = 64/69 (92%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPS SVLYCNRAACW KLG+WERSVEDC++AL IQPNY KALLRRAASN KLERWAE++R Sbjct: 467 DPSISVLYCNRAACWFKLGRWERSVEDCDQALSIQPNYIKALLRRAASNSKLERWAEAVR 526 Query: 181 DYEVLRREL 207 DYEVLRREL Sbjct: 527 DYEVLRREL 535 >ref|XP_007021715.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 3 [Theobroma cacao] gi|508721343|gb|EOY13240.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 3 [Theobroma cacao] Length = 656 Score = 127 bits (320), Expect = 1e-27 Identities = 59/69 (85%), Positives = 64/69 (92%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPS SVLYCNRAACW KLG+WERSVEDC++AL IQPNY KALLRRAASN KLERWAE++R Sbjct: 494 DPSISVLYCNRAACWFKLGRWERSVEDCDQALSIQPNYIKALLRRAASNSKLERWAEAVR 553 Query: 181 DYEVLRREL 207 DYEVLRREL Sbjct: 554 DYEVLRREL 562 >ref|XP_007021714.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 2 [Theobroma cacao] gi|508721342|gb|EOY13239.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 2 [Theobroma cacao] Length = 696 Score = 127 bits (320), Expect = 1e-27 Identities = 59/69 (85%), Positives = 64/69 (92%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPS SVLYCNRAACW KLG+WERSVEDC++AL IQPNY KALLRRAASN KLERWAE++R Sbjct: 494 DPSISVLYCNRAACWFKLGRWERSVEDCDQALSIQPNYIKALLRRAASNSKLERWAEAVR 553 Query: 181 DYEVLRREL 207 DYEVLRREL Sbjct: 554 DYEVLRREL 562 >ref|XP_007021713.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 1 [Theobroma cacao] gi|508721341|gb|EOY13238.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 1 [Theobroma cacao] Length = 698 Score = 127 bits (320), Expect = 1e-27 Identities = 59/69 (85%), Positives = 64/69 (92%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPS SVLYCNRAACW KLG+WERSVEDC++AL IQPNY KALLRRAASN KLERWAE++R Sbjct: 494 DPSISVLYCNRAACWFKLGRWERSVEDCDQALSIQPNYIKALLRRAASNSKLERWAEAVR 553 Query: 181 DYEVLRREL 207 DYEVLRREL Sbjct: 554 DYEVLRREL 562 >ref|XP_003541820.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Glycine max] Length = 692 Score = 127 bits (320), Expect = 1e-27 Identities = 57/69 (82%), Positives = 64/69 (92%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPSNSVLYCNRAACW KLGQWERS+ED N+AL IQPNYTKALLRRAASN KLERW E+++ Sbjct: 488 DPSNSVLYCNRAACWFKLGQWERSIEDSNQALHIQPNYTKALLRRAASNSKLERWEEAVK 547 Query: 181 DYEVLRREL 207 DYE+LR+EL Sbjct: 548 DYEILRKEL 556 >gb|ACU18444.1| unknown [Glycine max] Length = 377 Score = 127 bits (320), Expect = 1e-27 Identities = 57/69 (82%), Positives = 64/69 (92%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPSNSVLYCNRAACW KLGQWERS+ED N+AL IQPNYTKALLRRAASN KLERW E+++ Sbjct: 173 DPSNSVLYCNRAACWFKLGQWERSIEDSNQALHIQPNYTKALLRRAASNSKLERWEEAVK 232 Query: 181 DYEVLRREL 207 DYE+LR+EL Sbjct: 233 DYEILRKEL 241 >ref|XP_006592931.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 698 Score = 127 bits (319), Expect = 2e-27 Identities = 57/69 (82%), Positives = 64/69 (92%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPSNSVLYCNRAACW KLGQWE+S+ED N+AL IQPNYTKALLRRAASN KLERW E+++ Sbjct: 494 DPSNSVLYCNRAACWFKLGQWEQSIEDSNQALHIQPNYTKALLRRAASNSKLERWEEAVK 553 Query: 181 DYEVLRREL 207 DYE+LRREL Sbjct: 554 DYEILRREL 562 >ref|XP_003556806.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 676 Score = 126 bits (317), Expect = 3e-27 Identities = 57/69 (82%), Positives = 63/69 (91%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPSNSVLYCNRAACW KLGQWERS+EDCN+AL I PNYTKA+LRRAASN KLERW E++ Sbjct: 472 DPSNSVLYCNRAACWFKLGQWERSIEDCNQALCILPNYTKAILRRAASNSKLERWEEAVT 531 Query: 181 DYEVLRREL 207 DYE+LRREL Sbjct: 532 DYELLRREL 540 >ref|XP_004294076.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Fragaria vesca subsp. vesca] Length = 658 Score = 125 bits (315), Expect = 5e-27 Identities = 56/69 (81%), Positives = 63/69 (91%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPSNSVLYCNRAACW KLG WE S+EDCN+AL I+PNY+KALLRRAASN KLERW +++R Sbjct: 454 DPSNSVLYCNRAACWFKLGMWEHSIEDCNQALCIKPNYSKALLRRAASNSKLERWVDAVR 513 Query: 181 DYEVLRREL 207 DYEVLRREL Sbjct: 514 DYEVLRREL 522 >gb|EPS72637.1| hypothetical protein M569_02119, partial [Genlisea aurea] Length = 684 Score = 125 bits (313), Expect = 8e-27 Identities = 55/69 (79%), Positives = 64/69 (92%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 DPSNSVLYCNRAACW KLG WE+SV+DC++AL+IQPNY+KALLRRAA+N KLERW E++R Sbjct: 481 DPSNSVLYCNRAACWFKLGHWEKSVDDCDQALRIQPNYSKALLRRAAANSKLERWNEAVR 540 Query: 181 DYEVLRREL 207 DYE LRREL Sbjct: 541 DYEALRREL 549 >emb|CBI21978.3| unnamed protein product [Vitis vinifera] Length = 675 Score = 125 bits (313), Expect = 8e-27 Identities = 57/69 (82%), Positives = 62/69 (89%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 D SNSVLYCNRA CWSKLG WE+SVEDCN ALKIQPNYTKALLRRA SN KL +WAE+++ Sbjct: 471 DTSNSVLYCNRAVCWSKLGLWEKSVEDCNHALKIQPNYTKALLRRAVSNGKLGQWAEAVK 530 Query: 181 DYEVLRREL 207 DYEVLRREL Sbjct: 531 DYEVLRREL 539 >ref|XP_002276519.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Vitis vinifera] Length = 710 Score = 125 bits (313), Expect = 8e-27 Identities = 57/69 (82%), Positives = 62/69 (89%) Frame = +1 Query: 1 DPSNSVLYCNRAACWSKLGQWERSVEDCNRALKIQPNYTKALLRRAASNDKLERWAESIR 180 D SNSVLYCNRA CWSKLG WE+SVEDCN ALKIQPNYTKALLRRA SN KL +WAE+++ Sbjct: 506 DTSNSVLYCNRAVCWSKLGLWEKSVEDCNHALKIQPNYTKALLRRAVSNGKLGQWAEAVK 565 Query: 181 DYEVLRREL 207 DYEVLRREL Sbjct: 566 DYEVLRREL 574