BLASTX nr result
ID: Akebia25_contig00042391
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00042391 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006596427.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 ref|XP_007142200.1| hypothetical protein PHAVU_008G260600g [Phas... 73 5e-11 ref|XP_004490605.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_007017649.1| Pentatricopeptide repeat (PPR-like) superfam... 72 1e-10 ref|XP_003615696.1| Pentatricopeptide repeat-containing protein ... 72 1e-10 ref|XP_006575412.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 ref|XP_006341986.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 ref|XP_004238610.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 ref|XP_006435073.1| hypothetical protein CICLE_v10000229mg [Citr... 68 1e-09 emb|CBI19766.3| unnamed protein product [Vitis vinifera] 68 2e-09 emb|CAA06829.1| DYW7 protein [Arabidopsis thaliana] 66 4e-09 ref|XP_006416469.1| hypothetical protein EUTSA_v10006756mg [Eutr... 66 4e-09 ref|NP_173402.2| pentatricopeptide repeat-containing protein [Ar... 66 4e-09 gb|EXB97347.1| hypothetical protein L484_024210 [Morus notabilis] 66 6e-09 tpg|DAA56491.1| TPA: hypothetical protein ZEAMMB73_164599 [Zea m... 65 8e-09 gb|EAZ14402.1| hypothetical protein OsJ_04322 [Oryza sativa Japo... 65 8e-09 gb|EAY76739.1| hypothetical protein OsI_04695 [Oryza sativa Indi... 65 8e-09 ref|NP_001172681.1| Os01g0884800 [Oryza sativa Japonica Group] g... 65 8e-09 gb|EYU38829.1| hypothetical protein MIMGU_mgv1a001151mg [Mimulus... 65 1e-08 gb|EYU32070.1| hypothetical protein MIMGU_mgv1a017635mg, partial... 65 1e-08 >ref|XP_006596427.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Glycine max] Length = 896 Score = 72.8 bits (177), Expect = 5e-11 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 DCH TAK +SL YG EIYL DS C HHFK+G CSCRDYW Sbjct: 858 DCHDTAKYISLAYGCEIYLSDSNCLHHFKDGHCSCRDYW 896 >ref|XP_007142200.1| hypothetical protein PHAVU_008G260600g [Phaseolus vulgaris] gi|561015333|gb|ESW14194.1| hypothetical protein PHAVU_008G260600g [Phaseolus vulgaris] Length = 893 Score = 72.8 bits (177), Expect = 5e-11 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 DCH TAK +SL YG EIYL DS C HHFK+G CSCRDYW Sbjct: 855 DCHDTAKYISLAYGCEIYLSDSNCLHHFKDGHCSCRDYW 893 >ref|XP_004490605.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Cicer arietinum] Length = 888 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 DCH TAK +SL YG EIYL DS C HHFK G CSCRDYW Sbjct: 850 DCHDTAKYISLAYGCEIYLSDSNCLHHFKGGHCSCRDYW 888 >ref|XP_007017649.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|590593723|ref|XP_007017650.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508722977|gb|EOY14874.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508722978|gb|EOY14875.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] Length = 890 Score = 71.6 bits (174), Expect = 1e-10 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 +CH TAK +SL +G EIYL D KCFHHFKNGQCSC DYW Sbjct: 852 NCHLTAKYISLKFGCEIYLSDRKCFHHFKNGQCSCGDYW 890 >ref|XP_003615696.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355517031|gb|AES98654.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 887 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 DCH TAK +S+ YG EIYL DS C HHFK G CSCRDYW Sbjct: 849 DCHDTAKYISMAYGCEIYLSDSNCLHHFKGGHCSCRDYW 887 >ref|XP_006575412.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like isoform X1 [Glycine max] gi|571441335|ref|XP_006575413.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like isoform X2 [Glycine max] Length = 896 Score = 71.2 bits (173), Expect = 1e-10 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 DCH +AK +SL YG EIYL DS C HHFK+G CSCRDYW Sbjct: 858 DCHDSAKYISLAYGCEIYLSDSNCLHHFKDGHCSCRDYW 896 >ref|XP_006341986.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Solanum tuberosum] Length = 884 Score = 68.6 bits (166), Expect = 9e-10 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 DCH+ AKLVS Y REIY++DSKC HHFK+G CSC +YW Sbjct: 846 DCHRIAKLVSQKYEREIYIHDSKCLHHFKDGYCSCGNYW 884 >ref|XP_004238610.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Solanum lycopersicum] Length = 884 Score = 68.6 bits (166), Expect = 9e-10 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 DCH+ AKLVS Y REIY++DSKC HHFK+G CSC +YW Sbjct: 846 DCHRIAKLVSQKYEREIYIHDSKCLHHFKDGYCSCGNYW 884 >ref|XP_006435073.1| hypothetical protein CICLE_v10000229mg [Citrus clementina] gi|557537195|gb|ESR48313.1| hypothetical protein CICLE_v10000229mg [Citrus clementina] Length = 889 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 234 CHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 CHKTAK VS ++ EI+L DSKC HHFKNGQCSC DYW Sbjct: 852 CHKTAKYVSKMHHCEIFLADSKCLHHFKNGQCSCGDYW 889 >emb|CBI19766.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 DCH TAK +S++Y EIYL DSKC H FKNG+CSC DYW Sbjct: 456 DCHGTAKFLSMLYSCEIYLSDSKCLHWFKNGRCSCGDYW 494 >emb|CAA06829.1| DYW7 protein [Arabidopsis thaliana] Length = 406 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 DCH TAK VS YG +I L D++C HHFKNG CSC+DYW Sbjct: 368 DCHDTAKYVSKRYGCDILLEDTRCLHHFKNGDCSCKDYW 406 >ref|XP_006416469.1| hypothetical protein EUTSA_v10006756mg [Eutrema salsugineum] gi|557094240|gb|ESQ34822.1| hypothetical protein EUTSA_v10006756mg [Eutrema salsugineum] Length = 893 Score = 66.2 bits (160), Expect = 4e-09 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 DCH TAK +S YG +I L D++C HHFKNG CSC+DYW Sbjct: 855 DCHNTAKYISRRYGCDILLEDTRCLHHFKNGDCSCKDYW 893 >ref|NP_173402.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75263158|sp|Q9FXH1.1|PPR52_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g19720; AltName: Full=Protein DYW7 gi|10086495|gb|AAG12555.1|AC007797_15 Unknown Protein [Arabidopsis thaliana] gi|332191770|gb|AEE29891.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 894 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 DCH TAK VS YG +I L D++C HHFKNG CSC+DYW Sbjct: 856 DCHDTAKYVSKRYGCDILLEDTRCLHHFKNGDCSCKDYW 894 >gb|EXB97347.1| hypothetical protein L484_024210 [Morus notabilis] Length = 880 Score = 65.9 bits (159), Expect = 6e-09 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 +CH+TAK +S YG EIY+ DSKC H F NG CSC+DYW Sbjct: 842 NCHETAKYISKTYGCEIYVTDSKCLHRFSNGHCSCKDYW 880 >tpg|DAA56491.1| TPA: hypothetical protein ZEAMMB73_164599 [Zea mays] Length = 520 Score = 65.5 bits (158), Expect = 8e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 DCH K+V+ +YGREI L D+ CFHH K+G+CSC DYW Sbjct: 482 DCHTAIKMVAKVYGREIILRDANCFHHMKDGECSCGDYW 520 >gb|EAZ14402.1| hypothetical protein OsJ_04322 [Oryza sativa Japonica Group] Length = 490 Score = 65.5 bits (158), Expect = 8e-09 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 DCH K+V+ +YGREI L DS CFHH K+G CSC DYW Sbjct: 452 DCHAAIKMVAEVYGREIILRDSNCFHHMKDGSCSCGDYW 490 >gb|EAY76739.1| hypothetical protein OsI_04695 [Oryza sativa Indica Group] Length = 494 Score = 65.5 bits (158), Expect = 8e-09 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 DCH K+V+ +YGREI L DS CFHH K+G CSC DYW Sbjct: 456 DCHAAIKMVAEVYGREIILRDSNCFHHMKDGSCSCGDYW 494 >ref|NP_001172681.1| Os01g0884800 [Oryza sativa Japonica Group] gi|20161229|dbj|BAB90156.1| selenium-binding protein-like [Oryza sativa Japonica Group] gi|255673935|dbj|BAH91411.1| Os01g0884800 [Oryza sativa Japonica Group] Length = 517 Score = 65.5 bits (158), Expect = 8e-09 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 DCH K+V+ +YGREI L DS CFHH K+G CSC DYW Sbjct: 479 DCHAAIKMVAEVYGREIILRDSNCFHHMKDGSCSCGDYW 517 >gb|EYU38829.1| hypothetical protein MIMGU_mgv1a001151mg [Mimulus guttatus] Length = 876 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 +CH+ AKLVS +G EIY+ DSK HHFKNG CSCRDYW Sbjct: 838 NCHRFAKLVSKRHGCEIYISDSKSLHHFKNGVCSCRDYW 876 >gb|EYU32070.1| hypothetical protein MIMGU_mgv1a017635mg, partial [Mimulus guttatus] Length = 728 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 237 DCHKTAKLVSLIYGREIYLYDSKCFHHFKNGQCSCRDYW 121 DCH K VS +YGR I L DS CFHHF++G CSC DYW Sbjct: 690 DCHTAMKFVSAVYGRRIVLRDSNCFHHFRDGVCSCLDYW 728