BLASTX nr result
ID: Akebia25_contig00042371
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00042371 (495 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001228878.1| predicted protein [Chaetomium globosum CBS 1... 80 2e-13 ref|XP_001931755.1| predicted protein [Pyrenophora tritici-repen... 78 1e-12 gb|EMR72735.1| hypothetical protein UCREL1_205 [Eutypa lata UCREL1] 73 4e-11 >ref|XP_001228878.1| predicted protein [Chaetomium globosum CBS 148.51] gi|88182959|gb|EAQ90427.1| predicted protein [Chaetomium globosum CBS 148.51] Length = 535 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/52 (65%), Positives = 43/52 (82%) Frame = +2 Query: 140 FWFSTIVFLAGMGMQLSLLSITTSLKMTDKTDWTFGQIVAVTIWIPPLLEYV 295 FWF+T+VFLAG+GMQ+S+L+ L M D W+FGQ+VAVT+WIPPLLEYV Sbjct: 478 FWFATLVFLAGVGMQISVLATAIRLDMVDARGWSFGQVVAVTVWIPPLLEYV 529 >ref|XP_001931755.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973361|gb|EDU40860.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 216 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +2 Query: 152 TIVFLAGMGMQLSLLSITTSLKMTDKTDWTFGQIVAVTIWIPPLLEYVY 298 ++ LAG+GMQLSLLS++ SLKMTD DWTFGQIVA+ IW PPLL YVY Sbjct: 150 SVASLAGLGMQLSLLSVSLSLKMTDALDWTFGQIVAIAIWTPPLLGYVY 198 >gb|EMR72735.1| hypothetical protein UCREL1_205 [Eutypa lata UCREL1] Length = 507 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/51 (60%), Positives = 43/51 (84%) Frame = +2 Query: 149 STIVFLAGMGMQLSLLSITTSLKMTDKTDWTFGQIVAVTIWIPPLLEYVYK 301 +T+ FLAGMGMQLSLLS+ +L++ D W+FGQ+VAVTIW+PPL+E +Y+ Sbjct: 433 ATMAFLAGMGMQLSLLSVPWTLELVDPDGWSFGQVVAVTIWVPPLVELLYE 483