BLASTX nr result
ID: Akebia25_contig00042334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00042334 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65989.1| hypothetical protein VITISV_042146 [Vitis vinifera] 56 5e-06 >emb|CAN65989.1| hypothetical protein VITISV_042146 [Vitis vinifera] Length = 250 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 4/37 (10%) Frame = -1 Query: 255 ATYTTDE*TFAALGRQR----WQGRAFLCRDPHVQLL 157 AT TTDE TFAALGR + WQGRAFLCRDPHVQLL Sbjct: 190 ATTTTDECTFAALGRFQGEWGWQGRAFLCRDPHVQLL 226