BLASTX nr result
ID: Akebia25_contig00042311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00042311 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285375.1| PREDICTED: reticulon family protein-like [Vi... 55 1e-05 >ref|XP_002285375.1| PREDICTED: reticulon family protein-like [Vitis vinifera] gi|296090446|emb|CBI40265.3| unnamed protein product [Vitis vinifera] Length = 207 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -3 Query: 289 LTVPALYDKYQDHVDEKLSVANKILSTQYKKID 191 L+VP LYDKYQDH+D+KL V ++++ TQYKKID Sbjct: 157 LSVPVLYDKYQDHIDDKLRVTHRVVQTQYKKID 189