BLASTX nr result
ID: Akebia25_contig00042131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00042131 (220 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001791646.1| hypothetical protein SNOG_00985 [Phaeosphaer... 139 3e-31 ref|XP_007593688.1| 40S ribosomal protein S9 [Colletotrichum fio... 139 5e-31 gb|EAQ71318.1| hypothetical protein MGCH7_ch7g725 [Magnaporthe o... 139 5e-31 gb|ETS84867.1| 40S ribosomal protein S9 [Pestalotiopsis fici W10... 139 5e-31 gb|EOO01840.1| putative 40s ribosomal protein s9 protein [Tognin... 139 5e-31 gb|EON67669.1| 40S ribosomal protein S9 [Coniosporium apollinis ... 139 5e-31 gb|EMR72089.1| putative 40s ribosomal protein s9 protein [Eutypa... 139 5e-31 gb|EME85361.1| hypothetical protein MYCFIDRAFT_60241 [Pseudocerc... 139 5e-31 gb|ELR03231.1| 40S ribosomal protein S9 [Pseudogymnoascus destru... 139 5e-31 ref|XP_007273485.1| 40s ribosomal protein [Colletotrichum gloeos... 139 5e-31 gb|EJT79609.1| 40S ribosomal protein S9 [Gaeumannomyces graminis... 139 5e-31 emb|CCF33735.1| 40S ribosomal protein S9 [Colletotrichum higgins... 139 5e-31 ref|XP_003847713.1| 40S ribosomal protein S9 [Zymoseptoria triti... 139 5e-31 gb|EFQ29502.1| ribosomal protein S4 [Colletotrichum graminicola ... 139 5e-31 ref|XP_003007794.1| 40S ribosomal protein S9 [Verticillium alfal... 139 5e-31 ref|XP_003720755.1| 40S ribosomal protein S9 [Magnaporthe oryzae... 139 5e-31 gb|EUC34734.1| hypothetical protein COCCADRAFT_35663 [Bipolaris ... 138 7e-31 gb|EMF08137.1| 40S ribosomal protein S9 [Sphaerulina musiva SO2202] 138 7e-31 gb|EMD65693.1| hypothetical protein COCSADRAFT_35730 [Bipolaris ... 138 7e-31 ref|XP_007288535.1| 40S ribosomal protein S9 [Marssonina brunnea... 138 7e-31 >ref|XP_001791646.1| hypothetical protein SNOG_00985 [Phaeosphaeria nodorum SN15] gi|111071360|gb|EAT92480.1| hypothetical protein SNOG_00985 [Phaeosphaeria nodorum SN15] Length = 192 Score = 139 bits (351), Expect = 3e-31 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMRLDYVLALK+EDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMRLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >ref|XP_007593688.1| 40S ribosomal protein S9 [Colletotrichum fioriniae PJ7] gi|588902324|gb|EXF82658.1| 40S ribosomal protein S9 [Colletotrichum fioriniae PJ7] Length = 192 Score = 139 bits (349), Expect = 5e-31 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >gb|EAQ71318.1| hypothetical protein MGCH7_ch7g725 [Magnaporthe oryzae 70-15] gi|440468672|gb|ELQ37822.1| 40S ribosomal protein S9 [Magnaporthe oryzae Y34] gi|440486607|gb|ELQ66456.1| 40S ribosomal protein S9 [Magnaporthe oryzae P131] Length = 180 Score = 139 bits (349), Expect = 5e-31 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 62 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 121 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 122 RVGKQIVNVPSF 133 >gb|ETS84867.1| 40S ribosomal protein S9 [Pestalotiopsis fici W106-1] Length = 190 Score = 139 bits (349), Expect = 5e-31 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >gb|EOO01840.1| putative 40s ribosomal protein s9 protein [Togninia minima UCRPA7] Length = 191 Score = 139 bits (349), Expect = 5e-31 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >gb|EON67669.1| 40S ribosomal protein S9 [Coniosporium apollinis CBS 100218] Length = 191 Score = 139 bits (349), Expect = 5e-31 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >gb|EMR72089.1| putative 40s ribosomal protein s9 protein [Eutypa lata UCREL1] Length = 191 Score = 139 bits (349), Expect = 5e-31 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >gb|EME85361.1| hypothetical protein MYCFIDRAFT_60241 [Pseudocercospora fijiensis CIRAD86] Length = 193 Score = 139 bits (349), Expect = 5e-31 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >gb|ELR03231.1| 40S ribosomal protein S9 [Pseudogymnoascus destructans 20631-21] Length = 192 Score = 139 bits (349), Expect = 5e-31 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >ref|XP_007273485.1| 40s ribosomal protein [Colletotrichum gloeosporioides Nara gc5] gi|429862840|gb|ELA37447.1| 40s ribosomal protein [Colletotrichum gloeosporioides Nara gc5] gi|530474861|gb|EQB55027.1| hypothetical protein CGLO_05076 [Colletotrichum gloeosporioides Cg-14] Length = 191 Score = 139 bits (349), Expect = 5e-31 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >gb|EJT79609.1| 40S ribosomal protein S9 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 192 Score = 139 bits (349), Expect = 5e-31 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 74 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 133 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 134 RVGKQIVNVPSF 145 >emb|CCF33735.1| 40S ribosomal protein S9 [Colletotrichum higginsianum] Length = 191 Score = 139 bits (349), Expect = 5e-31 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >ref|XP_003847713.1| 40S ribosomal protein S9 [Zymoseptoria tritici IPO323] gi|339467586|gb|EGP82689.1| hypothetical protein MYCGRDRAFT_106533 [Zymoseptoria tritici IPO323] Length = 194 Score = 139 bits (349), Expect = 5e-31 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >gb|EFQ29502.1| ribosomal protein S4 [Colletotrichum graminicola M1.001] gi|477525810|gb|ENH77682.1| 40s ribosomal protein [Colletotrichum orbiculare MAFF 240422] Length = 191 Score = 139 bits (349), Expect = 5e-31 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >ref|XP_003007794.1| 40S ribosomal protein S9 [Verticillium alfalfae VaMs.102] gi|261353445|gb|EEY15873.1| 40S ribosomal protein S9 [Verticillium alfalfae VaMs.102] gi|346977464|gb|EGY20916.1| 40S ribosomal protein S9 [Verticillium dahliae VdLs.17] Length = 191 Score = 139 bits (349), Expect = 5e-31 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >ref|XP_003720755.1| 40S ribosomal protein S9 [Magnaporthe oryzae 70-15] gi|351638147|gb|EHA46012.1| 40S ribosomal protein S9 [Magnaporthe oryzae 70-15] Length = 191 Score = 139 bits (349), Expect = 5e-31 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >gb|EUC34734.1| hypothetical protein COCCADRAFT_35663 [Bipolaris zeicola 26-R-13] gi|576932613|gb|EUC46152.1| hypothetical protein COCMIDRAFT_93683 [Bipolaris oryzae ATCC 44560] gi|578484552|gb|EUN22073.1| hypothetical protein COCVIDRAFT_42086 [Bipolaris victoriae FI3] Length = 192 Score = 138 bits (348), Expect = 7e-31 Identities = 69/72 (95%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALK+EDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >gb|EMF08137.1| 40S ribosomal protein S9 [Sphaerulina musiva SO2202] Length = 193 Score = 138 bits (348), Expect = 7e-31 Identities = 69/72 (95%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALK+EDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >gb|EMD65693.1| hypothetical protein COCSADRAFT_35730 [Bipolaris sorokiniana ND90Pr] gi|451997276|gb|EMD89741.1| hypothetical protein COCHEDRAFT_1225361 [Bipolaris maydis C5] gi|477592976|gb|ENI10046.1| hypothetical protein COCC4DRAFT_185738 [Bipolaris maydis ATCC 48331] gi|482804545|gb|EOA81657.1| hypothetical protein SETTUDRAFT_98745 [Setosphaeria turcica Et28A] Length = 192 Score = 138 bits (348), Expect = 7e-31 Identities = 69/72 (95%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALK+EDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144 >ref|XP_007288535.1| 40S ribosomal protein S9 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406868496|gb|EKD21533.1| 40S ribosomal protein S9 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 193 Score = 138 bits (348), Expect = 7e-31 Identities = 69/72 (95%), Positives = 72/72 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDENRMRLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RM+LDYVLALK+EDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSF 218 RVGKQIVNVPSF Sbjct: 133 RVGKQIVNVPSF 144