BLASTX nr result
ID: Akebia25_contig00041935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00041935 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29825.3| unnamed protein product [Vitis vinifera] 63 5e-08 ref|XP_002278530.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 ref|XP_006848380.1| hypothetical protein AMTR_s00013p00202120 [A... 62 8e-08 ref|XP_007213627.1| hypothetical protein PRUPE_ppa002066mg [Prun... 62 1e-07 ref|XP_006340743.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_004233739.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 ref|XP_002529510.1| pentatricopeptide repeat-containing protein,... 59 9e-07 ref|XP_004295543.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 57 3e-06 >emb|CBI29825.3| unnamed protein product [Vitis vinifera] Length = 722 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/52 (53%), Positives = 37/52 (71%) Frame = -1 Query: 395 RGFTLMPPVCNRLIISLYSQDKKEHMFDLVTRMKSVGYNLDIYLDHSLKALL 240 +GF LMP +CN+L+ SL QDK +H DL+ RM S GY+LD YL H +K+ L Sbjct: 656 KGFMLMPRICNQLLRSLILQDKMKHALDLLNRMNSAGYDLDEYLHHRIKSYL 707 >ref|XP_002278530.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Vitis vinifera] Length = 798 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/52 (53%), Positives = 37/52 (71%) Frame = -1 Query: 395 RGFTLMPPVCNRLIISLYSQDKKEHMFDLVTRMKSVGYNLDIYLDHSLKALL 240 +GF LMP +CN+L+ SL QDK +H DL+ RM S GY+LD YL H +K+ L Sbjct: 732 KGFMLMPRICNQLLRSLILQDKMKHALDLLNRMNSAGYDLDEYLHHRIKSYL 783 >ref|XP_006848380.1| hypothetical protein AMTR_s00013p00202120 [Amborella trichopoda] gi|548851686|gb|ERN09961.1| hypothetical protein AMTR_s00013p00202120 [Amborella trichopoda] Length = 789 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = -1 Query: 389 FTLMPPVCNRLIISLYSQDKKEHMFDLVTRMKSVGYNLDIYLDHSLKALL 240 F LMPPVCNRLI SL SQ+K++ ++V RM SVGY+L +YLD + K+LL Sbjct: 734 FELMPPVCNRLIRSLCSQNKRKDAHEIVHRMASVGYDLGVYLDLTTKSLL 783 >ref|XP_007213627.1| hypothetical protein PRUPE_ppa002066mg [Prunus persica] gi|462409492|gb|EMJ14826.1| hypothetical protein PRUPE_ppa002066mg [Prunus persica] Length = 722 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/53 (54%), Positives = 39/53 (73%), Gaps = 1/53 (1%) Frame = -1 Query: 395 RGFTLMPPVCNRLIISLY-SQDKKEHMFDLVTRMKSVGYNLDIYLDHSLKALL 240 +GF LMP +CN+L+ L SQDKK+H DL++RM+S GY+LD YL + K LL Sbjct: 665 KGFMLMPEICNQLLKCLLRSQDKKDHALDLISRMRSFGYDLDFYLHQTTKFLL 717 >ref|XP_006340743.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Solanum tuberosum] Length = 775 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/55 (52%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = -1 Query: 395 RGFTLMPPVCNRLIISL-YSQDKKEHMFDLVTRMKSVGYNLDIYLDHSLKALLRK 234 RG LMP +CN+L+ SL +SQDK H F L+ RM+S GYNLD YL ++L R+ Sbjct: 721 RGVRLMPRICNKLLQSLLHSQDKAHHAFGLLERMRSTGYNLDDYLHRGTRSLFRQ 775 >ref|XP_004233739.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Solanum lycopersicum] Length = 753 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/55 (52%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = -1 Query: 395 RGFTLMPPVCNRLIISLY-SQDKKEHMFDLVTRMKSVGYNLDIYLDHSLKALLRK 234 RG LMP +CN+L+ SL SQDK +H F L+ RM+S GYNLD YL ++L R+ Sbjct: 699 RGVRLMPRICNKLLQSLLRSQDKAQHAFGLLERMRSTGYNLDDYLHRGTRSLFRQ 753 >ref|XP_002529510.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531026|gb|EEF32879.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 804 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/54 (51%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = -1 Query: 395 RGFTLMPPVCNRLIISLY-SQDKKEHMFDLVTRMKSVGYNLDIYLDHSLKALLR 237 +G+ LMP +CNRL+ SL S+DK+ FDL++RMKS+GY+LD +L + K LL+ Sbjct: 727 KGYMLMPRICNRLLKSLLRSEDKRNRAFDLLSRMKSLGYDLDSHLHQTTKFLLQ 780 >ref|XP_004295543.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g79540-like [Fragaria vesca subsp. vesca] Length = 768 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/54 (53%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -1 Query: 395 RGFTLMPPVCNRLIISLY-SQDKKEHMFDLVTRMKSVGYNLDIYLDHSLKALLR 237 RGF LMP +CN+L+ L S+DKK H FDLV RM++ GY+LD L + K LL+ Sbjct: 715 RGFMLMPEICNKLLKCLLRSRDKKGHAFDLVHRMRNFGYDLDACLHQTTKFLLQ 768