BLASTX nr result
ID: Akebia25_contig00041710
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00041710 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_538978.1| Ycf2 [Gossypium hirsutum] gi|91208964|ref|YP_53... 103 2e-20 ref|YP_008992938.1| hypothetical chloroplast RF21 (chloroplast) ... 103 2e-20 ref|YP_008992852.1| hypothetical chloroplast RF21 (chloroplast) ... 103 2e-20 ref|YP_008992766.1| hypothetical chloroplast RF21 (chloroplast) ... 103 2e-20 ref|YP_008992680.1| hypothetical chloroplast RF21 (chloroplast) ... 103 2e-20 ref|YP_008992593.1| hypothetical chloroplast RF21 (chloroplast) ... 103 2e-20 ref|YP_006503651.1| Ycf2 (chloroplast) [Gossypium robinsonii] gi... 103 2e-20 ref|YP_006503402.1| Ycf2 (chloroplast) [Gossypium somalense] gi|... 103 2e-20 ref|YP_006503319.1| Ycf2 (chloroplast) [Gossypium incanum] gi|39... 103 2e-20 ref|YP_006503485.1| Ycf2 (chloroplast) [Gossypium capitis-viridi... 103 2e-20 gb|AEB90554.1| Ycf2 (chloroplast) [Gossypium hirsutum] gi|329317... 103 2e-20 ref|YP_006303533.1| Ycf2 (chloroplast) [Gossypium gossypioides] ... 103 2e-20 ref|YP_005088322.1| Ycf2 (chloroplast) [Gossypium tomentosum] gi... 103 2e-20 ref|YP_005087735.1| Ycf2 (chloroplast) [Gossypium raimondii] gi|... 103 2e-20 ref|YP_005088418.1| Ycf2 (chloroplast) [Gossypium herbaceum subs... 103 2e-20 gb|AEX58497.1| hypothetical chloroplast RF21 (chloroplast) [Theo... 103 2e-20 ref|YP_004021358.2| hypothetical chloroplast RF21 [Theobroma cac... 103 2e-20 ref|YP_004286046.1| hypothetical chloroplast RF21 [Gossypium thu... 103 2e-20 gb|ABQ14831.1| Ycf2 [Hamamelis japonica] 103 2e-20 ref|YP_913230.1| hypothetical protein GobaCp066 [Gossypium barba... 103 2e-20 >ref|YP_538978.1| Ycf2 [Gossypium hirsutum] gi|91208964|ref|YP_538997.1| Ycf2 [Gossypium hirsutum] gi|372291071|ref|YP_005087831.1| Ycf2 (chloroplast) [Gossypium darwinii] gi|372291087|ref|YP_005087848.1| Ycf2 (chloroplast) [Gossypium darwinii] gi|372291814|ref|YP_005088958.1| Ycf2 (chloroplast) [Gossypium mustelinum] gi|372291829|ref|YP_005088975.1| Ycf2 (chloroplast) [Gossypium mustelinum] gi|109896299|sp|Q2L949.1|YCF2_GOSHI RecName: Full=Protein Ycf2 gi|85687457|gb|ABC73669.1| hypothetical chloroplast RF2 [Gossypium hirsutum] gi|85687478|gb|ABC73690.1| hypothetical chloroplast RF2 [Gossypium hirsutum] gi|318084439|gb|ADV38914.1| Ycf2 (chloroplast) [Gossypium darwinii] gi|318084455|gb|ADV38930.1| Ycf2 (chloroplast) [Gossypium darwinii] gi|318084609|gb|ADV39082.1| Ycf2 (chloroplast) [Gossypium mustelinum] gi|318084624|gb|ADV39097.1| Ycf2 (chloroplast) [Gossypium mustelinum] gi|329317280|gb|AEB90637.1| ycf2 (chloroplast) [Gossypium hirsutum] gi|329317296|gb|AEB90653.1| Ycf2 (chloroplast) [Gossypium hirsutum] gi|329317364|gb|AEB90720.1| ycf2 (chloroplast) [Gossypium barbadense] gi|329317380|gb|AEB90736.1| Ycf2 (chloroplast) [Gossypium barbadense] gi|329317448|gb|AEB90803.1| Ycf2 (chloroplast) [Gossypium barbadense] gi|329317464|gb|AEB90819.1| Ycf2 (chloroplast) [Gossypium barbadense] gi|329317532|gb|AEB90886.1| ycf2 (chloroplast) [Gossypium barbadense] gi|329317548|gb|AEB90902.1| Ycf2 (chloroplast) [Gossypium barbadense] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1811 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1870 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1871 ISITQKK 1877 >ref|YP_008992938.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium sturtianum] gi|326457519|gb|ADZ74778.1| hypothetical chloroplast RF21 [Gossypium sturtianum] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1813 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1872 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1873 ISITQKK 1879 >ref|YP_008992852.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium stocksii] gi|570879979|ref|YP_008992871.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium stocksii] gi|326457431|gb|ADZ74691.1| hypothetical chloroplast RF21 [Gossypium stocksii] gi|326457454|gb|ADZ74714.1| hypothetical chloroplast RF21 [Gossypium stocksii] Length = 2296 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1811 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1870 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1871 ISITQKK 1877 >ref|YP_008992766.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium longicalyx] gi|570759726|ref|YP_008992785.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium longicalyx] gi|326457343|gb|ADZ74604.1| hypothetical chloroplast RF21 [Gossypium longicalyx] gi|326457365|gb|ADZ74626.1| hypothetical chloroplast RF21 [Gossypium longicalyx] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1813 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1872 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1873 ISITQKK 1879 >ref|YP_008992680.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium herbaceum] gi|570759640|ref|YP_008992699.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium herbaceum] gi|326457258|gb|ADZ74520.1| hypothetical chloroplast RF21 [Gossypium herbaceum] gi|326457279|gb|ADZ74541.1| hypothetical chloroplast RF21 [Gossypium herbaceum] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1813 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1872 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1873 ISITQKK 1879 >ref|YP_008992593.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium bickii] gi|570759034|ref|YP_008992613.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium bickii] gi|326457169|gb|ADZ74432.1| hypothetical chloroplast RF21 [Gossypium bickii] gi|326457193|gb|ADZ74456.1| hypothetical chloroplast RF21 [Gossypium bickii] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1813 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1872 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1873 ISITQKK 1879 >ref|YP_006503651.1| Ycf2 (chloroplast) [Gossypium robinsonii] gi|394831032|ref|YP_006503668.1| Ycf2 (chloroplast) [Gossypium robinsonii] gi|335354708|gb|AEH43324.1| Ycf2 [Gossypium robinsonii] gi|335354724|gb|AEH43340.1| Ycf2 [Gossypium robinsonii] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1813 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1872 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1873 ISITQKK 1879 >ref|YP_006503402.1| Ycf2 (chloroplast) [Gossypium somalense] gi|394830770|ref|YP_006503419.1| Ycf2 (chloroplast) [Gossypium somalense] gi|394830929|ref|YP_006503568.1| Ycf2 (chloroplast) [Gossypium areysianum] gi|394830945|ref|YP_006503585.1| Ycf2 (chloroplast) [Gossypium areysianum] gi|335354456|gb|AEH43075.1| Ycf2 [Gossypium somalense] gi|335354472|gb|AEH43091.1| Ycf2 [Gossypium somalense] gi|335354624|gb|AEH43241.1| Ycf2 (chloroplast) [Gossypium areysianum] gi|335354640|gb|AEH43257.1| Ycf2 (chloroplast) [Gossypium areysianum] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1813 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1872 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1873 ISITQKK 1879 >ref|YP_006503319.1| Ycf2 (chloroplast) [Gossypium incanum] gi|394830683|ref|YP_006503336.1| Ycf2 (chloroplast) [Gossypium incanum] gi|335354372|gb|AEH42992.1| Ycf2 [Gossypium incanum] gi|335354388|gb|AEH43008.1| Ycf2 [Gossypium incanum] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1813 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1872 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1873 ISITQKK 1879 >ref|YP_006503485.1| Ycf2 (chloroplast) [Gossypium capitis-viridis] gi|394830856|ref|YP_006503502.1| Ycf2 (chloroplast) [Gossypium capitis-viridis] gi|570758921|ref|YP_008992507.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium anomalum] gi|570758946|ref|YP_008992526.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium anomalum] gi|326457080|gb|ADZ74344.1| hypothetical chloroplast RF21 [Gossypium anomalum] gi|326457105|gb|ADZ74369.1| hypothetical chloroplast RF21 [Gossypium anomalum] gi|335354540|gb|AEH43158.1| Ycf2 (chloroplast) [Gossypium capitis-viridis] gi|335354556|gb|AEH43174.1| Ycf2 (chloroplast) [Gossypium capitis-viridis] Length = 2302 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1819 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1878 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1879 ISITQKK 1885 >gb|AEB90554.1| Ycf2 (chloroplast) [Gossypium hirsutum] gi|329317212|gb|AEB90570.1| Ycf2 (chloroplast) [Gossypium hirsutum] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1811 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1870 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1871 ISITQKK 1877 >ref|YP_006303533.1| Ycf2 (chloroplast) [Gossypium gossypioides] gi|386800894|ref|YP_006303550.1| Ycf2 (chloroplast) [Gossypium gossypioides] gi|329317112|gb|AEB90471.1| Ycf2 (chloroplast) [Gossypium gossypioides] gi|329317128|gb|AEB90487.1| Ycf2 (chloroplast) [Gossypium gossypioides] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1813 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1872 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1873 ISITQKK 1879 >ref|YP_005088322.1| Ycf2 (chloroplast) [Gossypium tomentosum] gi|372291443|ref|YP_005088339.1| Ycf2 (chloroplast) [Gossypium tomentosum] gi|318084777|gb|ADV39248.1| Ycf2 (chloroplast) [Gossypium tomentosum] gi|318084794|gb|ADV39265.1| Ycf2 (chloroplast) [Gossypium tomentosum] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1811 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1870 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1871 ISITQKK 1877 >ref|YP_005087735.1| Ycf2 (chloroplast) [Gossypium raimondii] gi|372290984|ref|YP_005087752.1| Ycf2 (chloroplast) [Gossypium raimondii] gi|318084688|gb|ADV39160.1| Ycf2 (chloroplast) [Gossypium raimondii] gi|318084702|gb|ADV39174.1| Ycf2 (chloroplast) [Gossypium raimondii] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1813 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1872 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1873 ISITQKK 1879 >ref|YP_005088418.1| Ycf2 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|372291541|ref|YP_005088435.1| Ycf2 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|372291898|ref|YP_005089041.1| Ycf2 (chloroplast) [Gossypium arboreum] gi|372291913|ref|YP_005089058.1| Ycf2 (chloroplast) [Gossypium arboreum] gi|318084357|gb|ADV38833.1| Ycf2 (chloroplast) [Gossypium arboreum] gi|318084372|gb|ADV38848.1| Ycf2 (chloroplast) [Gossypium arboreum] gi|318084525|gb|ADV38999.1| Ycf2 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|318084542|gb|ADV39016.1| Ycf2 (chloroplast) [Gossypium herbaceum subsp. africanum] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1813 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1872 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1873 ISITQKK 1879 >gb|AEX58497.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma grandiflorum] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1813 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1872 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1873 ISITQKK 1879 >ref|YP_004021358.2| hypothetical chloroplast RF21 [Theobroma cacao] gi|342240210|ref|YP_004021375.2| hypothetical chloroplast RF21 [Theobroma cacao] gi|328924822|gb|ADO64933.2| hypothetical chloroplast RF21 [Theobroma cacao] gi|328924840|gb|ADO64951.2| hypothetical chloroplast RF21 [Theobroma cacao] gi|339518939|gb|ADO64851.2| hypothetical chloroplast RF21 [Theobroma cacao] gi|339518940|gb|ADO64868.2| hypothetical chloroplast RF21 [Theobroma cacao] gi|371925978|gb|AEX57768.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371925995|gb|AEX57785.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926060|gb|AEX57849.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926077|gb|AEX57866.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926142|gb|AEX57930.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926159|gb|AEX57947.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926224|gb|AEX58011.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926241|gb|AEX58028.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926306|gb|AEX58092.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926323|gb|AEX58109.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926388|gb|AEX58173.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926405|gb|AEX58190.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926470|gb|AEX58254.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926487|gb|AEX58271.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926552|gb|AEX58335.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926569|gb|AEX58352.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926634|gb|AEX58416.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926651|gb|AEX58433.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926733|gb|AEX58514.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma grandiflorum] gi|371926798|gb|AEX58578.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] gi|371926815|gb|AEX58595.1| hypothetical chloroplast RF21 (chloroplast) [Theobroma cacao] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1813 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1872 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1873 ISITQKK 1879 >ref|YP_004286046.1| hypothetical chloroplast RF21 [Gossypium thurberi] gi|325210992|ref|YP_004286065.1| hypothetical chloroplast RF21 [Gossypium thurberi] gi|290775831|gb|ADD62327.1| hypothetical chloroplast RF21 [Gossypium thurberi] gi|290775854|gb|ADD62350.1| hypothetical chloroplast RF21 [Gossypium thurberi] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1813 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1872 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1873 ISITQKK 1879 >gb|ABQ14831.1| Ycf2 [Hamamelis japonica] Length = 2292 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1812 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1871 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1872 ISITQKK 1878 >ref|YP_913230.1| hypothetical protein GobaCp066 [Gossypium barbadense] gi|119368560|ref|YP_913247.1| hypothetical protein GobaCp086 [Gossypium barbadense] gi|125991251|sp|A0ZZ78.1|YCF2_GOSBA RecName: Full=Protein Ycf2 gi|119224904|dbj|BAF41290.1| Hypothetical protein [Gossypium barbadense] gi|119224922|dbj|BAF41308.1| Hypothetical protein [Gossypium barbadense] Length = 2298 Score = 103 bits (258), Expect = 2e-20 Identities = 51/67 (76%), Positives = 55/67 (82%) Frame = +2 Query: 2 NTCIKIRKFFIPQQ*KHFFTLPYFRGFQLEKKMFHTNGYGSITIDSNARHLVTLTIEGQS 181 NTCIKIR+ IPQQ KHFFTL Y RGF LEKKMFHTNG+GSIT+ SNAR LV LT E S Sbjct: 1811 NTCIKIRRLLIPQQRKHFFTLSYTRGFHLEKKMFHTNGFGSITVGSNARDLVALTNEALS 1870 Query: 182 ISITKKK 202 ISIT+KK Sbjct: 1871 ISITQKK 1877