BLASTX nr result
ID: Akebia25_contig00041651
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00041651 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON60971.1| hypothetical protein W97_00181 [Coniosporium apol... 74 3e-11 gb|EME40639.1| hypothetical protein DOTSEDRAFT_74250 [Dothistrom... 73 4e-11 gb|EMR69822.1| putative phosphate metabolism protein 7 protein [... 71 1e-10 ref|XP_003849643.1| hypothetical protein MYCGRDRAFT_47614, parti... 71 1e-10 gb|EME78489.1| hypothetical protein MYCFIDRAFT_58545 [Pseudocerc... 71 2e-10 gb|EMF09695.1| DUF221-domain-containing protein [Sphaerulina mus... 69 5e-10 gb|EMC91709.1| hypothetical protein BAUCODRAFT_79204 [Baudoinia ... 69 5e-10 gb|ETS82771.1| hypothetical protein PFICI_04647 [Pestalotiopsis ... 67 2e-09 dbj|GAD98176.1| DUF221 domain protein [Byssochlamys spectabilis ... 67 2e-09 gb|ETN42046.1| hypothetical protein HMPREF1541_03985 [Cyphelloph... 67 3e-09 gb|EEQ89006.1| DUF221 domain-containing protein [Ajellomyces der... 67 3e-09 ref|XP_002628213.1| DUF221 domain-containing protein [Ajellomyce... 67 3e-09 gb|EHK45966.1| hypothetical protein TRIATDRAFT_139793 [Trichoder... 66 4e-09 gb|EQK99382.1| DUF221 domain-containing protein [Ophiocordyceps ... 65 7e-09 gb|EFY84345.1| DUF221 domain-containing protein [Metarhizium acr... 65 1e-08 gb|EHK20870.1| hypothetical protein TRIVIDRAFT_180828 [Trichoder... 65 1e-08 gb|EYE95765.1| DUF221-domain-containing protein [Aspergillus rub... 64 2e-08 ref|XP_001827431.1| hypothetical protein AOR_1_720024 [Aspergill... 64 2e-08 emb|CCE33597.1| related to A.thaliana hyp1 protein [Claviceps pu... 64 2e-08 gb|EFQ31003.1| hypothetical protein GLRG_06147 [Colletotrichum g... 64 2e-08 >gb|EON60971.1| hypothetical protein W97_00181 [Coniosporium apollinis CBS 100218] Length = 873 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/55 (61%), Positives = 43/55 (78%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIPRDP G+S +E+RDT K + ITD GA LDEKNK+VWD + + API+E+ VYY Sbjct: 820 WIPRDPAGVSRQEVRDTGKVIAITDVGAHLDEKNKIVWD-DPNISAPIHEEKVYY 873 >gb|EME40639.1| hypothetical protein DOTSEDRAFT_74250 [Dothistroma septosporum NZE10] Length = 881 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/55 (60%), Positives = 42/55 (76%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIPRDP+G+S +EIRDT K + +TDEGA LD KNKV WD + + PIYE+ +YY Sbjct: 828 WIPRDPVGISRQEIRDTSKIIPMTDEGAYLDAKNKVCWD-AKDGRPPIYEEKIYY 881 >gb|EMR69822.1| putative phosphate metabolism protein 7 protein [Eutypa lata UCREL1] Length = 859 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/55 (52%), Positives = 43/55 (78%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIP DP+G+S +E+RDT K + ITDEG LD+KNK++WD E + + P++E+ +YY Sbjct: 806 WIPEDPMGISKQEVRDTGKVIPITDEGCVLDDKNKLIWDTE-AVRPPVWEEKIYY 859 >ref|XP_003849643.1| hypothetical protein MYCGRDRAFT_47614, partial [Zymoseptoria tritici IPO323] gi|339469520|gb|EGP84619.1| hypothetical protein MYCGRDRAFT_47614 [Zymoseptoria tritici IPO323] Length = 846 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/55 (58%), Positives = 43/55 (78%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIPRD LG+S RE+++T K + ITDEGASLDE+ K+VWD + + PI+E+ VYY Sbjct: 793 WIPRDALGVSRREVKETGKVVPITDEGASLDEEGKIVWDRD-GGRPPIWEEKVYY 846 >gb|EME78489.1| hypothetical protein MYCFIDRAFT_58545 [Pseudocercospora fijiensis CIRAD86] Length = 886 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/55 (56%), Positives = 41/55 (74%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIPRDP+G+S +E+ DT K + ITDEGA LD+KN V WD + + PIYE+ +YY Sbjct: 833 WIPRDPVGISRQEVADTGKVIPITDEGAYLDDKNNVCWDADEG-RPPIYEEKIYY 886 >gb|EMF09695.1| DUF221-domain-containing protein [Sphaerulina musiva SO2202] Length = 884 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/55 (58%), Positives = 41/55 (74%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 W+PRD LG+S +EI +T K + ITDEGA LDEK K+VWD E + PIYE+ +YY Sbjct: 831 WVPRDNLGVSKQEIAETSKVIPITDEGAFLDEKAKIVWDAE-DGRPPIYEEKIYY 884 >gb|EMC91709.1| hypothetical protein BAUCODRAFT_79204 [Baudoinia compniacensis UAMH 10762] Length = 869 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/55 (56%), Positives = 41/55 (74%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIPRDP+G+S +E+RDT + ITDEGA LD+K K+VWD + + PIYE+ YY Sbjct: 816 WIPRDPVGISRQEVRDTNHIIPITDEGAYLDDKGKIVWD-AQDGRPPIYEETPYY 869 >gb|ETS82771.1| hypothetical protein PFICI_04647 [Pestalotiopsis fici W106-1] Length = 854 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/55 (50%), Positives = 43/55 (78%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIP DP G+S +E+RDT + + ITDEG +L++KNK+ WD+E + + P++E+ VYY Sbjct: 801 WIPEDPAGISKQEVRDTSRVIPITDEGCTLNDKNKLEWDSEGA-RPPLWEEKVYY 854 >dbj|GAD98176.1| DUF221 domain protein [Byssochlamys spectabilis No. 5] Length = 895 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/55 (54%), Positives = 42/55 (76%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIPRDP G+S +E++ + K + ITDE A LDEKNK+ WD+E + + PIYE+ +YY Sbjct: 842 WIPRDPAGVSRQEVKHSLKVIPITDEDAWLDEKNKIHWDSE-TGRPPIYEEKIYY 895 >gb|ETN42046.1| hypothetical protein HMPREF1541_03985 [Cyphellophora europaea CBS 101466] Length = 897 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/55 (52%), Positives = 40/55 (72%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIPRD LG+SA+E T K +TDEGA L+EK K+VW++ ++ PIYE+ +YY Sbjct: 843 WIPRDELGVSAQECVHTNKVTPMTDEGAYLNEKGKIVWNHASDERPPIYEEKIYY 897 >gb|EEQ89006.1| DUF221 domain-containing protein [Ajellomyces dermatitidis ER-3] gi|327354371|gb|EGE83228.1| DUF221 domain-containing protein [Ajellomyces dermatitidis ATCC 18188] gi|531978574|gb|EQL29161.1| hypothetical protein BDFG_08175 [Ajellomyces dermatitidis ATCC 26199] Length = 875 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/55 (52%), Positives = 40/55 (72%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIPRD G+S +E+ T K + ITDE A++DEKNK+ W NE + PIYE+P++Y Sbjct: 822 WIPRDAGGVSRQEVAHTSKVIAITDEDATIDEKNKITW-NEEKGRPPIYEEPIHY 875 >ref|XP_002628213.1| DUF221 domain-containing protein [Ajellomyces dermatitidis SLH14081] gi|239590310|gb|EEQ72891.1| DUF221 domain-containing protein [Ajellomyces dermatitidis SLH14081] Length = 875 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/55 (52%), Positives = 40/55 (72%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIPRD G+S +E+ T K + ITDE A++DEKNK+ W NE + PIYE+P++Y Sbjct: 822 WIPRDAGGVSRQEVAHTSKVIAITDEDATIDEKNKITW-NEEKGRPPIYEEPIHY 875 >gb|EHK45966.1| hypothetical protein TRIATDRAFT_139793 [Trichoderma atroviride IMI 206040] Length = 888 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/55 (56%), Positives = 40/55 (72%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIP DP GLS EI + K +QITDEGA LDEKN + WD+E + + PI+E+ +YY Sbjct: 835 WIPSDPAGLSKVEIAASSKVIQITDEGAVLDEKNHITWDSEGA-RPPIWEEKIYY 888 >gb|EQK99382.1| DUF221 domain-containing protein [Ophiocordyceps sinensis CO18] Length = 877 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/55 (52%), Positives = 41/55 (74%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIP+DP G+S +E+ T K + ITDEGA+LDEKN + WD E + + PI+++ VYY Sbjct: 824 WIPQDPAGVSKQEVALTSKVIAITDEGATLDEKNTITWDTEGA-RPPIWQEKVYY 877 >gb|EFY84345.1| DUF221 domain-containing protein [Metarhizium acridum CQMa 102] Length = 813 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/58 (50%), Positives = 41/58 (70%), Gaps = 3/58 (5%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQ---APIYEKPVYY 175 W+PRDP+G+S EI T + + I+D+GA LDEKN VVW + +D+ PIY++ VYY Sbjct: 756 WVPRDPIGVSKHEIALTSRVIPISDKGAHLDEKNNVVWSEDLTDKEELPPIYDEKVYY 813 >gb|EHK20870.1| hypothetical protein TRIVIDRAFT_180828 [Trichoderma virens Gv29-8] Length = 884 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/55 (50%), Positives = 41/55 (74%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIP DP GLS +E+ ++ K + ITDEGA LDEKN + WD+E + + PI+E+ ++Y Sbjct: 831 WIPSDPAGLSKQEVAESSKVIPITDEGAVLDEKNHITWDSEGA-RPPIWEEKIHY 884 >gb|EYE95765.1| DUF221-domain-containing protein [Aspergillus ruber CBS 135680] Length = 879 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/55 (52%), Positives = 39/55 (70%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIPRDPLG+S +E+ T K + ITDE A LDEKN + WD ++ PIY++ +YY Sbjct: 826 WIPRDPLGISKQEVAHTSKVISITDEDAWLDEKNALQWDVDKG-APPIYKEKIYY 879 >ref|XP_001827431.1| hypothetical protein AOR_1_720024 [Aspergillus oryzae RIB40] gi|83776179|dbj|BAE66298.1| unnamed protein product [Aspergillus oryzae RIB40] gi|391866365|gb|EIT75637.1| hypothetical protein Ao3042_08396 [Aspergillus oryzae 3.042] Length = 895 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/55 (52%), Positives = 40/55 (72%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIPRD +G+S +EI+ T + + ITDE A LDEKNK+ WD ++ PIYE+ +YY Sbjct: 842 WIPRDEIGVSKQEIKHTSRVIAITDEDAWLDEKNKIHWDMDKG-VPPIYEEKIYY 895 >emb|CCE33597.1| related to A.thaliana hyp1 protein [Claviceps purpurea 20.1] Length = 875 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/58 (53%), Positives = 38/58 (65%), Gaps = 3/58 (5%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQA---PIYEKPVYY 175 W+P DPLG+S EI T + + I+DEGA LDEKN VVW + SDQ PIY + YY Sbjct: 818 WVPEDPLGVSKHEIALTSRVIPISDEGAWLDEKNGVVWSEDLSDQGKMPPIYTEKAYY 875 >gb|EFQ31003.1| hypothetical protein GLRG_06147 [Colletotrichum graminicola M1.001] Length = 885 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/55 (52%), Positives = 39/55 (70%) Frame = -2 Query: 339 WIPRDPLGLSAREIRDTPKELQITDEGASLDEKNKVVWDNERSDQAPIYEKPVYY 175 WIP D G+S EI T K + ITDEG LDEKNK+VWD+E + + PI+++ +YY Sbjct: 832 WIPEDAAGVSKSEIAQTSKIIPITDEGCQLDEKNKLVWDSEAA-RPPIWDEKIYY 885