BLASTX nr result
ID: Akebia25_contig00041629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00041629 (512 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40818.1| hypothetical protein MIMGU_mgv1a010013mg [Mimulus... 61 2e-07 gb|EYU20926.1| hypothetical protein MIMGU_mgv1a023283mg [Mimulus... 59 7e-07 gb|EXB89365.1| Putative lipid phosphate phosphatase 3 [Morus not... 56 5e-06 ref|XP_002526288.1| phosphatidic acid phosphatase, putative [Ric... 56 6e-06 ref|XP_006448393.1| hypothetical protein CICLE_v10015826mg [Citr... 55 8e-06 >gb|EYU40818.1| hypothetical protein MIMGU_mgv1a010013mg [Mimulus guttatus] Length = 324 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 430 TFGNVICHGKDSDIREGHKSFPSGHTS 510 T+GNV+CHGKDSDIREGHKSFPSGHTS Sbjct: 165 TWGNVVCHGKDSDIREGHKSFPSGHTS 191 >gb|EYU20926.1| hypothetical protein MIMGU_mgv1a023283mg [Mimulus guttatus] Length = 313 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 433 FGNVICHGKDSDIREGHKSFPSGHTS 510 +GNV+CHGKDSDIREGHKSFPSGHTS Sbjct: 166 WGNVVCHGKDSDIREGHKSFPSGHTS 191 >gb|EXB89365.1| Putative lipid phosphate phosphatase 3 [Morus notabilis] Length = 343 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = +1 Query: 433 FGNVICHGKDSDIREGHKSFPSGHTS 510 +G+VICHGKDSDI+EGHKSFPSGHTS Sbjct: 167 WGDVICHGKDSDIKEGHKSFPSGHTS 192 >ref|XP_002526288.1| phosphatidic acid phosphatase, putative [Ricinus communis] gi|223534369|gb|EEF36077.1| phosphatidic acid phosphatase, putative [Ricinus communis] Length = 311 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 436 GNVICHGKDSDIREGHKSFPSGHTS 510 G+VICHGKDSDI+EGHKSFPSGHTS Sbjct: 167 GDVICHGKDSDIKEGHKSFPSGHTS 191 >ref|XP_006448393.1| hypothetical protein CICLE_v10015826mg [Citrus clementina] gi|568828868|ref|XP_006468759.1| PREDICTED: putative lipid phosphate phosphatase 3, chloroplastic-like [Citrus sinensis] gi|557551004|gb|ESR61633.1| hypothetical protein CICLE_v10015826mg [Citrus clementina] Length = 343 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +1 Query: 421 YEKTFGNVICHGKDSDIREGHKSFPSGHTS 510 Y +G+V+CHGKDS++REGHKSFPSGHTS Sbjct: 163 YGGHWGDVVCHGKDSEVREGHKSFPSGHTS 192