BLASTX nr result
ID: Akebia25_contig00041159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00041159 (237 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF09228.1| kinesin-domain-containing protein [Sphaerulina mu... 79 5e-13 gb|EME78523.1| hypothetical protein MYCFIDRAFT_87840 [Pseudocerc... 79 5e-13 gb|EME40505.1| hypothetical protein DOTSEDRAFT_136681 [Dothistro... 79 5e-13 gb|EMC91845.1| hypothetical protein BAUCODRAFT_38988 [Baudoinia ... 79 5e-13 ref|XP_003849589.1| hypothetical protein MYCGRDRAFT_47142 [Zymos... 79 5e-13 gb|EON67399.1| hypothetical protein W97_06652 [Coniosporium apol... 70 3e-10 gb|EKG19157.1| hypothetical protein MPH_03527 [Macrophomina phas... 69 7e-10 ref|XP_007585440.1| putative kinesin family protein [Neofusicocc... 68 2e-09 ref|XP_001797457.1| hypothetical protein SNOG_07104 [Phaeosphaer... 66 6e-09 gb|EUN25086.1| hypothetical protein COCVIDRAFT_28364 [Bipolaris ... 65 8e-09 gb|EUC27941.1| hypothetical protein COCCADRAFT_9595 [Bipolaris z... 65 8e-09 gb|EMD91686.1| hypothetical protein COCHEDRAFT_1030464 [Bipolari... 65 8e-09 gb|EMD61446.1| hypothetical protein COCSADRAFT_28790 [Bipolaris ... 65 8e-09 ref|XP_003835822.1| similar to kinesin family protein [Leptospha... 65 8e-09 ref|XP_003300537.1| hypothetical protein PTT_11785 [Pyrenophora ... 65 8e-09 ref|XP_001931100.1| chromosome-associated kinesin KIF4 [Pyrenoph... 65 8e-09 gb|AAO59296.1| kinesin [Bipolaris maydis] gi|477591485|gb|ENI085... 65 8e-09 ref|XP_002145322.1| kinesin family protein [Talaromyces marneffe... 65 1e-08 gb|EUC50144.1| hypothetical protein COCMIDRAFT_1107 [Bipolaris o... 64 2e-08 dbj|GAD93175.1| conserved hypothetical protein [Byssochlamys spe... 64 2e-08 >gb|EMF09228.1| kinesin-domain-containing protein [Sphaerulina musiva SO2202] Length = 1769 Score = 79.3 bits (194), Expect = 5e-13 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEME +RK Sbjct: 1663 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMENWRK 1704 >gb|EME78523.1| hypothetical protein MYCFIDRAFT_87840 [Pseudocercospora fijiensis CIRAD86] Length = 1663 Score = 79.3 bits (194), Expect = 5e-13 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEME +RK Sbjct: 1558 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMENWRK 1599 >gb|EME40505.1| hypothetical protein DOTSEDRAFT_136681 [Dothistroma septosporum NZE10] Length = 1757 Score = 79.3 bits (194), Expect = 5e-13 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEME +RK Sbjct: 1652 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMENWRK 1693 >gb|EMC91845.1| hypothetical protein BAUCODRAFT_38988 [Baudoinia compniacensis UAMH 10762] Length = 1837 Score = 79.3 bits (194), Expect = 5e-13 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEME +RK Sbjct: 1732 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMEVWRK 1773 >ref|XP_003849589.1| hypothetical protein MYCGRDRAFT_47142 [Zymoseptoria tritici IPO323] gi|339469466|gb|EGP84565.1| hypothetical protein MYCGRDRAFT_47142 [Zymoseptoria tritici IPO323] Length = 1632 Score = 79.3 bits (194), Expect = 5e-13 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEME +RK Sbjct: 1527 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMENWRK 1568 >gb|EON67399.1| hypothetical protein W97_06652 [Coniosporium apollinis CBS 100218] Length = 1719 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLEEAL DLE+S+ +TKSE+E +RK Sbjct: 1613 RIRTIEKHLFAEKQLTATLEEALTDLESSSTKTKSEIEAWRK 1654 >gb|EKG19157.1| hypothetical protein MPH_03527 [Macrophomina phaseolina MS6] Length = 1721 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLEEAL DLE S+ + K+EMET++K Sbjct: 1615 RIRTIEKHLFAEKQLTATLEEALTDLEASSTKVKNEMETWKK 1656 >ref|XP_007585440.1| putative kinesin family protein [Neofusicoccum parvum UCRNP2] gi|485921380|gb|EOD47120.1| putative kinesin family protein [Neofusicoccum parvum UCRNP2] Length = 1567 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLEEAL DLE S+ + K+EM+T++K Sbjct: 1461 RIRTIEKHLFAEKQLTATLEEALTDLEASSTKVKNEMDTWKK 1502 >ref|XP_001797457.1| hypothetical protein SNOG_07104 [Phaeosphaeria nodorum SN15] gi|160701554|gb|EAT85755.2| hypothetical protein SNOG_07104 [Phaeosphaeria nodorum SN15] Length = 1660 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLE+AL DLE S +TK++++ YRK Sbjct: 1553 RIRTIEKHLFAEKQLTATLEDALTDLEASNTKTKTDLDQYRK 1594 >gb|EUN25086.1| hypothetical protein COCVIDRAFT_28364 [Bipolaris victoriae FI3] Length = 1728 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLE+AL DLE S+ +TK++++ +RK Sbjct: 1621 RIRTIEKHLFAEKQLTATLEDALTDLEASSTKTKADLDQFRK 1662 >gb|EUC27941.1| hypothetical protein COCCADRAFT_9595 [Bipolaris zeicola 26-R-13] Length = 1727 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLE+AL DLE S+ +TK++++ +RK Sbjct: 1620 RIRTIEKHLFAEKQLTATLEDALTDLEASSTKTKADLDQFRK 1661 >gb|EMD91686.1| hypothetical protein COCHEDRAFT_1030464 [Bipolaris maydis C5] Length = 1878 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLE+AL DLE S+ +TK++++ +RK Sbjct: 1771 RIRTIEKHLFAEKQLTATLEDALTDLEASSTKTKADLDQFRK 1812 >gb|EMD61446.1| hypothetical protein COCSADRAFT_28790 [Bipolaris sorokiniana ND90Pr] Length = 1727 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLE+AL DLE S+ +TK++++ +RK Sbjct: 1620 RIRTIEKHLFAEKQLTATLEDALTDLEASSTKTKADLDQFRK 1661 >ref|XP_003835822.1| similar to kinesin family protein [Leptosphaeria maculans JN3] gi|312212374|emb|CBX92457.1| similar to kinesin family protein [Leptosphaeria maculans JN3] Length = 1712 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLE+AL DLE S+++TK E+E +K Sbjct: 1607 RIRTIEKHLFAEKQLTATLEDALTDLEASSSKTKQELEVMKK 1648 >ref|XP_003300537.1| hypothetical protein PTT_11785 [Pyrenophora teres f. teres 0-1] gi|311325311|gb|EFQ91363.1| hypothetical protein PTT_11785 [Pyrenophora teres f. teres 0-1] Length = 1707 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLE+AL DLE S+ +TK++++ +RK Sbjct: 1600 RIRTIEKHLFAEKQLTATLEDALTDLEASSTKTKTDLDQFRK 1641 >ref|XP_001931100.1| chromosome-associated kinesin KIF4 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187972706|gb|EDU40205.1| chromosome-associated kinesin KIF4 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1712 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLE+AL DLE S+ +TK++++ +RK Sbjct: 1605 RIRTIEKHLFAEKQLTATLEDALTDLEASSTKTKTDLDQFRK 1646 >gb|AAO59296.1| kinesin [Bipolaris maydis] gi|477591485|gb|ENI08557.1| hypothetical protein COCC4DRAFT_129155 [Bipolaris maydis ATCC 48331] Length = 1695 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLE+AL DLE S+ +TK++++ +RK Sbjct: 1588 RIRTIEKHLFAEKQLTATLEDALTDLEASSTKTKADLDQFRK 1629 >ref|XP_002145322.1| kinesin family protein [Talaromyces marneffei ATCC 18224] gi|210074720|gb|EEA28807.1| kinesin family protein [Talaromyces marneffei ATCC 18224] Length = 1741 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RI+TIEKHL+AEKQLTATLEEAL DLET +N+ K++ME ++K Sbjct: 1638 RIKTIEKHLYAEKQLTATLEEALGDLETQSNKIKADMEAWKK 1679 >gb|EUC50144.1| hypothetical protein COCMIDRAFT_1107 [Bipolaris oryzae ATCC 44560] Length = 1727 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHLFAEKQLTATLE+AL DLE S+ +T+++++ +RK Sbjct: 1620 RIRTIEKHLFAEKQLTATLEDALTDLEASSTKTRADLDQFRK 1661 >dbj|GAD93175.1| conserved hypothetical protein [Byssochlamys spectabilis No. 5] Length = 1751 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = +1 Query: 112 RIRTIEKHLFAEKQLTATLEEALVDLETSANRTKSEMETYRK 237 RIRTIEKHL+AEKQLTATLEEAL DLE +N+ K++ME ++K Sbjct: 1648 RIRTIEKHLYAEKQLTATLEEALGDLEAQSNKVKADMEAWKK 1689