BLASTX nr result
ID: Akebia25_contig00040917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00040917 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73386.1| hypothetical protein VITISV_006445 [Vitis vinifera] 62 6e-08 >emb|CAN73386.1| hypothetical protein VITISV_006445 [Vitis vinifera] Length = 196 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +3 Query: 114 LEEVMD*DHLNMAERVFKFLELLDNRKIKLVAIKLKGYA*SWWQQVQM 257 L EV+D LN ERVF+FL L +N+K+K+V IKLKGY SWWQQVQM Sbjct: 125 LXEVLD--WLNEVERVFEFLNLPENKKVKMVVIKLKGYXSSWWQQVQM 170