BLASTX nr result
ID: Akebia25_contig00040740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00040740 (475 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC18117.1| hypothetical protein L484_014518 [Morus notabilis... 56 6e-06 >gb|EXC18117.1| hypothetical protein L484_014518 [Morus notabilis] gi|587934836|gb|EXC21739.1| hypothetical protein L484_006452 [Morus notabilis] Length = 293 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = +3 Query: 339 RIRCSSSNPDFSVTTDQLEKYASMTGGAFDFKGATPSLTHGLIHS 473 RI CS S+PD +T+D+LE A MTGGAFDFK AT SLT LI S Sbjct: 40 RILCSYSSPDMPLTSDKLENSAPMTGGAFDFKKATISLTDELISS 84