BLASTX nr result
ID: Akebia25_contig00040570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00040570 (470 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001802687.1| hypothetical protein SNOG_12465 [Phaeosphaer... 56 5e-06 >ref|XP_001802687.1| hypothetical protein SNOG_12465 [Phaeosphaeria nodorum SN15] gi|160703634|gb|EAT80278.2| hypothetical protein SNOG_12465 [Phaeosphaeria nodorum SN15] Length = 936 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/55 (47%), Positives = 36/55 (65%) Frame = +3 Query: 3 TQQKGEDLKSVAALVSEKKVKVIVDSVFAWEDAPKAYGHLAKWSSKGKVIVKVKQ 167 TQ +L+ + + E K+K +VDS+F WEDAPKAY L +KGK++VKV Q Sbjct: 879 TQASKPNLEQLGQWMQEGKLKPVVDSIFEWEDAPKAYEKLKSGRAKGKIVVKVPQ 933