BLASTX nr result
ID: Akebia25_contig00040567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00040567 (242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518959.1| Auxin-induced protein 5NG4, putative [Ricinu... 87 3e-15 ref|XP_002317651.2| hypothetical protein POPTR_0011s15150g [Popu... 83 3e-14 ref|XP_004309563.1| PREDICTED: auxin-induced protein 5NG4-like [... 83 3e-14 emb|CBI34638.3| unnamed protein product [Vitis vinifera] 83 5e-14 ref|XP_007039289.1| Nodulin MtN21 /EamA-like transporter family ... 80 3e-13 ref|XP_007039288.1| Nodulin MtN21 /EamA-like transporter family ... 80 3e-13 ref|XP_007039287.1| Nodulin MtN21 /EamA-like transporter family ... 80 3e-13 ref|XP_002273800.2| PREDICTED: auxin-induced protein 5NG4-like [... 80 3e-13 ref|XP_007208872.1| hypothetical protein PRUPE_ppa026053mg [Prun... 79 5e-13 gb|EXC17367.1| Auxin-induced protein 5NG4 [Morus notabilis] 79 7e-13 ref|XP_006493416.1| PREDICTED: WAT1-related protein At5g64700-li... 78 1e-12 ref|XP_006441413.1| hypothetical protein CICLE_v10023533mg [Citr... 78 1e-12 ref|XP_006441412.1| hypothetical protein CICLE_v10020812mg [Citr... 76 6e-12 emb|CBI34636.3| unnamed protein product [Vitis vinifera] 73 5e-11 ref|XP_007039285.1| Nodulin MtN21 /EamA-like transporter family ... 71 1e-10 ref|XP_004309501.1| PREDICTED: auxin-induced protein 5NG4-like [... 71 1e-10 ref|XP_002271326.2| PREDICTED: auxin-induced protein 5NG4-like [... 71 1e-10 ref|XP_004309502.1| PREDICTED: auxin-induced protein 5NG4-like [... 64 3e-08 ref|XP_002283348.1| PREDICTED: auxin-induced protein 5NG4 isofor... 60 3e-07 ref|XP_002308862.2| hypothetical protein POPTR_0006s03200g [Popu... 60 4e-07 >ref|XP_002518959.1| Auxin-induced protein 5NG4, putative [Ricinus communis] gi|223541946|gb|EEF43492.1| Auxin-induced protein 5NG4, putative [Ricinus communis] Length = 372 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/55 (72%), Positives = 48/55 (87%) Frame = -1 Query: 167 SCACYLAMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 +C Y AM+ VQLAYGGSNIL+KI+L+KGL+Q VFVVYRHLIAM ++GP AYVLE Sbjct: 3 TCTSYAAMILVQLAYGGSNILMKIALEKGLNQLVFVVYRHLIAMILVGPFAYVLE 57 >ref|XP_002317651.2| hypothetical protein POPTR_0011s15150g [Populus trichocarpa] gi|550328442|gb|EEE98263.2| hypothetical protein POPTR_0011s15150g [Populus trichocarpa] Length = 366 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/56 (67%), Positives = 49/56 (87%) Frame = -1 Query: 170 RSCACYLAMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 ++CA Y AM+ VQ AYGGSNIL+KI+L+KGL+Q VFVVYRH+IA+ +LGP AYV+E Sbjct: 2 QACAPYAAMLLVQFAYGGSNILMKIALEKGLNQIVFVVYRHVIAVILLGPFAYVIE 57 >ref|XP_004309563.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. vesca] Length = 359 Score = 83.2 bits (204), Expect = 3e-14 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -1 Query: 155 YLAMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 YLAMV VQLAYGGSN+LIK+SL +GLD VFVVYRH+IAM +LGP AYVLE Sbjct: 7 YLAMVLVQLAYGGSNVLIKLSLAEGLDPIVFVVYRHVIAMLLLGPFAYVLE 57 >emb|CBI34638.3| unnamed protein product [Vitis vinifera] Length = 365 Score = 82.8 bits (203), Expect = 5e-14 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = -1 Query: 155 YLAMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 Y AMV +QLAYGGSNILIKI++DKGL+Q VFVVYRH+IAM +LGP AYV E Sbjct: 7 YGAMVLIQLAYGGSNILIKIAIDKGLNQIVFVVYRHIIAMLLLGPFAYVFE 57 >ref|XP_007039289.1| Nodulin MtN21 /EamA-like transporter family protein isoform 3 [Theobroma cacao] gi|508776534|gb|EOY23790.1| Nodulin MtN21 /EamA-like transporter family protein isoform 3 [Theobroma cacao] Length = 369 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/56 (66%), Positives = 47/56 (83%) Frame = -1 Query: 170 RSCACYLAMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 ++C +AMV VQ AYGGSNILIKI+L++GL+QFV +VYRH+IAM +L P AYVLE Sbjct: 2 KNCGFIVAMVVVQFAYGGSNILIKIALERGLNQFVLIVYRHIIAMLLLAPPAYVLE 57 >ref|XP_007039288.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2 [Theobroma cacao] gi|508776533|gb|EOY23789.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2 [Theobroma cacao] Length = 327 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/56 (66%), Positives = 47/56 (83%) Frame = -1 Query: 170 RSCACYLAMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 ++C +AMV VQ AYGGSNILIKI+L++GL+QFV +VYRH+IAM +L P AYVLE Sbjct: 2 KNCGFIVAMVVVQFAYGGSNILIKIALERGLNQFVLIVYRHIIAMLLLAPPAYVLE 57 >ref|XP_007039287.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 [Theobroma cacao] gi|508776532|gb|EOY23788.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 [Theobroma cacao] Length = 375 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/56 (66%), Positives = 47/56 (83%) Frame = -1 Query: 170 RSCACYLAMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 ++C +AMV VQ AYGGSNILIKI+L++GL+QFV +VYRH+IAM +L P AYVLE Sbjct: 2 KNCGFIVAMVVVQFAYGGSNILIKIALERGLNQFVLIVYRHIIAMLLLAPPAYVLE 57 >ref|XP_002273800.2| PREDICTED: auxin-induced protein 5NG4-like [Vitis vinifera] Length = 356 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -1 Query: 146 MVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 MV +QLAYGGSNILIKI++DKGL+Q VFVVYRH+IAM +LGP AYV E Sbjct: 1 MVLIQLAYGGSNILIKIAIDKGLNQIVFVVYRHIIAMLLLGPFAYVFE 48 >ref|XP_007208872.1| hypothetical protein PRUPE_ppa026053mg [Prunus persica] gi|462404607|gb|EMJ10071.1| hypothetical protein PRUPE_ppa026053mg [Prunus persica] Length = 359 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = -1 Query: 164 CACYLAMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 C+ YLAMV VQL YGGSNILIK SL +GL+ VFVVYRH++AM ++GP AYVLE Sbjct: 4 CSYYLAMVLVQLIYGGSNILIKFSLAEGLNPIVFVVYRHVMAMVLVGPFAYVLE 57 >gb|EXC17367.1| Auxin-induced protein 5NG4 [Morus notabilis] Length = 331 Score = 79.0 bits (193), Expect = 7e-13 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -1 Query: 155 YLAMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 Y+AMV VQLA GGSNIL+K+SLD+GLD VFVVYRHLIAM +LGP A+ LE Sbjct: 7 YVAMVVVQLALGGSNILMKVSLDRGLDLLVFVVYRHLIAMVLLGPFAFALE 57 >ref|XP_006493416.1| PREDICTED: WAT1-related protein At5g64700-like [Citrus sinensis] Length = 359 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/51 (68%), Positives = 46/51 (90%) Frame = -1 Query: 155 YLAMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 Y+A++F Q A+ GSNIL+KI+L++GL+Q VFVVYRH+IAMF+LGP AYVLE Sbjct: 9 YMAIIFNQFAFAGSNILMKIALERGLNQLVFVVYRHVIAMFLLGPFAYVLE 59 >ref|XP_006441413.1| hypothetical protein CICLE_v10023533mg [Citrus clementina] gi|557543675|gb|ESR54653.1| hypothetical protein CICLE_v10023533mg [Citrus clementina] Length = 345 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/51 (70%), Positives = 44/51 (86%) Frame = -1 Query: 155 YLAMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 Y+AM+ VQ AYGGSNIL+KISL+KGL+ VFVVYRH++AM +LG AYVLE Sbjct: 7 YVAMILVQFAYGGSNILVKISLEKGLNHLVFVVYRHVLAMVLLGAFAYVLE 57 >ref|XP_006441412.1| hypothetical protein CICLE_v10020812mg [Citrus clementina] gi|557543674|gb|ESR54652.1| hypothetical protein CICLE_v10020812mg [Citrus clementina] Length = 357 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/51 (66%), Positives = 45/51 (88%) Frame = -1 Query: 155 YLAMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 Y+A++F Q A+ GSNIL+KI+L++GL+Q VFVVYRH+IAM +LGP AYVLE Sbjct: 7 YMAIIFNQFAFAGSNILMKIALERGLNQLVFVVYRHVIAMLLLGPFAYVLE 57 >emb|CBI34636.3| unnamed protein product [Vitis vinifera] Length = 366 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = -1 Query: 149 AMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 AMV VQLA GGS IL+ I++DKGL+Q VFVVYRH+IAM +LGP AYVLE Sbjct: 9 AMVLVQLANGGSIILMGIAMDKGLNQIVFVVYRHIIAMLLLGPFAYVLE 57 >ref|XP_007039285.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma cacao] gi|508776530|gb|EOY23786.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma cacao] Length = 376 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/50 (64%), Positives = 42/50 (84%) Frame = -1 Query: 152 LAMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 +AMV +Q +YG S IL+K++ ++GL+QFVFV YRH+IAMFVLGP AYV E Sbjct: 15 VAMVLLQSSYGASVILVKVAFERGLNQFVFVAYRHIIAMFVLGPFAYVRE 64 >ref|XP_004309501.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. vesca] Length = 352 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/48 (64%), Positives = 42/48 (87%) Frame = -1 Query: 146 MVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 M+ VQ+AYGGS++L+K+SL++GL VFVVYRH++AMF+L P AYVLE Sbjct: 1 MILVQIAYGGSSVLVKLSLEEGLKPVVFVVYRHVMAMFLLAPFAYVLE 48 >ref|XP_002271326.2| PREDICTED: auxin-induced protein 5NG4-like [Vitis vinifera] Length = 357 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -1 Query: 146 MVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 MV VQLA GGS IL+ I++DKGL+Q VFVVYRH+IAM +LGP AYVLE Sbjct: 1 MVLVQLANGGSIILMGIAMDKGLNQIVFVVYRHIIAMLLLGPFAYVLE 48 >ref|XP_004309502.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. vesca] Length = 352 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/54 (55%), Positives = 40/54 (74%) Frame = -1 Query: 164 CACYLAMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 C YLAMV Q+++G ++IL K SL +GLD VFVVYRH++AM +L P AY +E Sbjct: 4 CNYYLAMVVAQVSFGVTSILTKFSLLQGLDPVVFVVYRHVLAMLLLAPFAYFIE 57 >ref|XP_002283348.1| PREDICTED: auxin-induced protein 5NG4 isoform 1 [Vitis vinifera] gi|297741692|emb|CBI32824.3| unnamed protein product [Vitis vinifera] Length = 396 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/54 (48%), Positives = 36/54 (66%) Frame = -1 Query: 164 CACYLAMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 C Y+AM+ +Q Y G NI+ K+SL++G+ +V VVYRH A V+ P A VLE Sbjct: 14 CKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALVLE 67 >ref|XP_002308862.2| hypothetical protein POPTR_0006s03200g [Populus trichocarpa] gi|550335355|gb|EEE92385.2| hypothetical protein POPTR_0006s03200g [Populus trichocarpa] Length = 405 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/54 (46%), Positives = 36/54 (66%) Frame = -1 Query: 164 CACYLAMVFVQLAYGGSNILIKISLDKGLDQFVFVVYRHLIAMFVLGPMAYVLE 3 C Y+AM+ +Q Y G NI+ K+SL++G+ +V VVYRH A V+ P A +LE Sbjct: 14 CKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAIILE 67